PRGDB00070846 (Mdo.10802)

From PRG Wiki
Jump to: navigation, search
Mdo.10802
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 77417485 (DQ184948)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR
Gene Species Malus x domestica

Comment?

Malus x domestica putative receptor kinase (DIPM1) mRNA, complete cds

DNA Sequence

ACttcctccctccactatccatgacccaccgcccaccatgattcccttcctcctcctcctcctcctcctcctcGCCACCGCCGTCCACCCCTCCACTTCCCTTCCATTCCCACCGCCGCCTCCAAACCTCCTCCTCCCATCCTCCGACGCCGTCGCCCTCCTGTCCTTCAAATCCCAAGCCGACCTCAACAACAAGCTCCTCTACACCCTCAACGAGCGCTTCGACTACTGCCAATGGCAGGGCGTCAAGTGCTCCCAGGGCCGCGTCGTCCGCTACGTCCTCCAGTCCTTCTCTCTCCGTGGCTCCTTCCCTCCCGACACCCTCTCCCGCCTCGACCAGCTCCGCGTCCTCAGCCTCCACAACAACTCCCTCTCCGGCCCCATCCCCGACCTCTCCCCTCTCCAGAACCTCAAGTCCCTCTTCCTCAACCGCAACTCCTTCTCCGGCTTCTTTCCCCCCTCCATCCTCGCCATCCACCGCCTCACCGTCCTCGATCTCTCCTTCAACGACCTCTCCGGTCCCATTCCCGACAACCTCTCTGGCCTGGACCGGCTCACCTCACTCCAGCTCCAGTCCAACCGCTTCAACGGCTCCCTCCCGGGTCTGAACCAGTCCTTCCTTTTAATCTTCAACGTCTCCTTTAACAACCTGACCGGCCCGGTTCCCCCTTCCCTGTCCCGGTTCGACGCGTCGTCGTTTCAGCTCAACCCGGGGCTCTGCGGCGAGACTGTGAACCGGGCGTGCAGGTTGCACGCCCCATTCTTCGAATCTCGCAATGCCAGTTCAACCTCTCCGGCGTCGGAGCCGCTGGGGGAGAGCACTGCACAGTCTCAGGGAGTTGTTCTGTCTCCGCCTTCCCCGAAAAACCACAAGAAAACTGGCGTCATCCTCGGCGTCGCAATCGGGGTTTCGCTCCTCGTCGCCGCCGTCTTATGCCTCTTTGCGGTGGCTCGAAATCATAACAAAACCATCACTTACACAGACACAAAACCGTCGCCAATTACCTCACCAGCCAATCGCATTCACTCTAATCCAAACAATTTCAGAACCATCGAAGCACAGATCCCAGAACGGAGGGAGGTGGTGCAGTTTTCCGACAAGGTAAAGACAGTTGAACAAGCAGCTCCTCCGAGAGCAATTCCAAGGAGCGGGAACTTGATTTTTTGCTACGGGGAGGCTCAGCTATACAGTCTGGAGCAGCTGATGAGAGCCTCGGCGGAGTTGCTCGGGAGGGGTAGCATTGGGACTACGTACAAGGCGGTGCTGGACAACCAGCTGATTGTGACGGTGAAGAGATTGGACGCCGGCAAGACGGCGATTACAAGCGGAGAAGCGTTTGAGGAGCATATGGACGTTGTGGGTGGGTTGCGGCATCCGTATCTGGTTCCGGTGAGGGCGTATTTTCAGGCAAAGGGAGAGCGGCTGGTGATCTATGATTACCAACCCAACGGCAGTCTATTCAATCTCATTCACGGTTCGAAATCAACTAGAGCAAGACCTCTGCATTGGACATCATGCTTGAAGATAGCTGAAGATGTAGCTCAAGGCCTTGCTTACATTCACCAATCGTCGTCCCTCATCCATGGCAATCTCAAGTCCTCCAATGTTCTCCTCGGAGGCGACTTCGAGGCCTGTCTCACGGACTACGGCCTTGCCTTCTTTGCGGACACTTCTGCAAATGAAGATCCTGATTCTGCAGGCTATAAAGCCCCCGAGATTCGCAAGTCCAGTAGGCGAGCCACGTCCAAATCCGATGTCTATGCCTTCGGCATCTTATTGCTTGAGCTCTTGACGGGTAAACATCCGTCCCAACATCCGCTTCTCGTGCCCACGGACGTGCCTGATTGGGTCAGAGTAATGAGGGATGACGATGTTGGGGATGACAATCAACTGGGAATGCTCACCGAGGTCGCTTGTATTTGTAGTTTGACGTCTCCGGAACAGAGGCCGGCAATGTGGCAAGTGTTGAAGATGATACAGGAGATTAAAGAGAGTGTGATGACTGACGATAACGCAGACGTCGGATTTTCCAAGTAGTAGAGTCTGGAGACTACAATTTTGGGTTCAAATAAGTAAATCAAGGGAGGAGGTTGAAACAATTCTAATCAAGGGGATGAGGTTGCAGAACGGATTTATAGGGCAAAGCTTGAGGAATTCTTGTAATTGCATTCACACGAGCGCAATCTGGTAATGGAAGATATATAATGATGATTTTAAGCATTCTTTCTTTCTTGTTTTGCCAGAGTTTTTGGTACAATGATGGCAAGGTGGTGATAAGTTTGGAATATTGTCACCTTGACAACCCGTTGCATGTGAATTTCTTTCGGAATTGTGTGGTTTTTGGTGCAAGCATGGATGATGTACCCATAttttttttattttGATAATCATAAAAAAAAGTAAGAATATGTGAATTGATTaaaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Mdo.10802 translated coding region predicted by ESTScan from UniGene Mdo.10802

XLPPSTIHDPPPTMIPFLLLLLLLLATAVHPSTSLPFPPPPPNLLLPSSDAVALLSFKSQADLNNKLLYTLNERFDYCQWQGVKCSQGRVVRYVLQSFSLRGSFPPDTLSRLDQLRVLSLHNNSLSGPIPDLSPLQNLKSLFLNRNSFSGFFPPSILAIHRLTVLDLSFNDLSGPIPDNLSGLDRLTSLQLQSNRFNGSLPGLNQSFLLIFNVSFNNLTGPVPPSLSRFDASSFQLNPGLCGETVNRACRLHAPFFESRNASSTSPASEPLGESTAQSQGVVLSPPSPKNHKKTGVILGVAIGVSLLVAAVLCLFAVARNHNKTITYTDTKPSPITSPANRIHSNPNNFRTIEAQIPERREVVQFSDKVKTVEQAAPPRAIPRSGNLIFCYGEAQLYSLEQLMRASAELLGRGSIGTTYKAVLDNQLIVTVKRLDAGKTAITSGEAFEEHMDVVGGLRHPYLVPVRAYFQAKGERLVIYDYQPNGSLFNLIHGSKSTRARPLHWTSCLKIAEDVAQGLAYIHQSSSLIHGNLKSSNVLLGGDFEACLTDYGLAFFADTSANEDPDSAGYKAPEIRKSSRRATSKSDVYAFGILLLELLTGKHPSQHPLLVPTDVPDWVRVMRDDDVGDDNQLGMLTEVACICSLTSPEQRPAMWQVLKMIQEIKESVMTDDNADVGFSK

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
4-665 FAMILY NOT NAMED,FAMILY NOT NAMED

PSTIHDPPPTMIPFLLLLLLLLATAVHPSTSLPFPPPPPNLLLPSSDAVALLSFKSQADLNNKLLYTLNERFDYCQWQGVKCSQGRVVRYVLQSFSLRGSFPPDTLSRLDQLRVLSLHNNSLSGPIPDLSPLQNLKSLFLNRNSFSGFFPPSILAIHRLTVLDLSFNDLSGPIPDNLSGLDRLTSLQLQSNRFNGSLPGLNQSFLLIFNVSFNNLTGPVPPSLSRFDASSFQLNPGLCGETVNRACRLHAPFFESRNASSTSPASEPLGESTAQSQGVVLSPPSPKNHKKTGVILGVAIGVSLLVAAVLCLFAVARNHNKTITYTDTKPSPITSPANRIHSNPNNFRTIEAQIPERREVVQFSDKVKTVEQAAPPRAIPRSGNLIFCYGEAQLYSLEQLMRASAELLGRGSIGTTYKAVLDNQLIVTVKRLDAGKTAITSGEAFEEHMDVVGGLRHPYLVPVRAYFQAKGERLVIYDYQPNGSLFNLIHGSKSTRARPLHWTSCLKIAEDVAQGLAYIHQSSSLIHGNLKSSNVLLGGDFEACLTDYGLAFFADTSANEDPDSAGYKAPEIRKSSRRATSKSDVYAFGILLLELLTGKHPSQHPLLVPTDVPDWVRVMRDDDVGDDNQLGMLTEVACICSLTSPEQRPAMWQVLKMIQEIKE

Seg: seg
18-25 seg

LLLLLLLL

Seg: seg
31-49 seg

PSTSLPFPPPPPNLLLPSS

superfamily: SSF52058
43-237 L domain-like,LRR

NLLLPSSDAVALLSFKSQADLNNKLLYTLNERFDYCQWQGVKCSQGRVVRYVLQSFSLRGSFPPDTLSRLDQLRVLSLHNNSLSGPIPDLSPLQNLKSLFLNRNSFSGFFPPSILAIHRLTVLDLSFNDLSGPIPDNLSGLDRLTSLQLQSNRFNGSLPGLNQSFLLIFNVSFNNLTGPVPPSLSRFDASSFQLN

Gene3D: G3DSA:3.80.10.10
49-229 no description

SDAVALLSFKSQADLNNKLLYTLNERFDYCQWQGVKCSQGRVVRYVLQSFSLRGSFPPDTLSRLDQLRVLSLHNNSLSGPIPDLSPLQNLKSLFLNRNSFSGFFPPSILAIHRLTVLDLSFNDLSGPIPDNLSGLDRLTSLQLQSNRFNGSLPGLNQSFLLIFNVSFNNLTGPVPPSLSRF

ProfileScan: PS51450
IPR001611
114-136 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLRVLSLHNNSLSGPIPDLSPLQ

HMMPfam: PF00560
IPR001611
114-133 LRR_1
Leucine-rich repeat

QLRVLSLHNNSLSGPIPDLS

ProfileScan: PS51450
IPR001611
137-158 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLKSLFLNRNSFSGFFPPSILA

ProfileScan: PS51450
IPR001611
161-184 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RLTVLDLSFNDLSGPIPDNLSGLD

HMMPfam: PF00560
IPR001611
161-183 LRR_1
Leucine-rich repeat

RLTVLDLSFNDLSGPIPDNLSGL

ProfileScan: PS51450
IPR001611
185-207 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RLTSLQLQSNRFNGSLPGLNQSF

Seg: seg
304-318 seg

VSLLVAAVLCLFAVA

superfamily: SSF56112
IPR011009
381-669 Protein kinase-like (PK-like)
Protein kinase-like domain

IPRSGNLIFCYGEAQLYSLEQLMRASAELLGRGSIGTTYKAVLDNQLIVTVKRLDAGKTAITSGEAFEEHMDVVGGLRHPYLVPVRAYFQAKGERLVIYDYQPNGSLFNLIHGSKSTRARPLHWTSCLKIAEDVAQGLAYIHQSSSLIHGNLKSSNVLLGGDFEACLTDYGLAFFADTSANEDPDSAGYKAPEIRKSSRRATSKSDVYAFGILLLELLTGKHPSQHPLLVPTDVPDWVRVMRDDDVGDDNQLGMLTEVACICSLTSPEQRPAMWQVLKMIQEIKESVMT

ProfileScan: PS50011
IPR000719
404-668 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

RASAELLGRGSIGTTYKAVLDNQLIVTVKRLDAGKTAITSGEAFEEHMDVVGGLRHPYLVPVRAYFQAKGERLVIYDYQPNGSLFNLIHGSKSTRARPLHWTSCLKIAEDVAQGLAYIHQSSSLIHGNLKSSNVLLGGDFEACLTDYGLAFFADTSANEDPDSAGYKAPEIRKSSRRATSKSDVYAFGILLLELLTGKHPSQHPLLVPTDVPDWVRVMRDDDVGDDNQLGMLTEVACICSLTSPEQRPAMWQVLKMIQEIKESVM

HMMSmart: SM00220
IPR002290
404-669 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

RASAELLGRGSIGTTYKAVLDNQLIVTVKRLDAGKTAITSGEAFEEHMDVVGGLRHPYLVPVRAYFQAKGERLVIYDYQPNGSLFNLIHGSKSTRARPLHWTSCLKIAEDVAQGLAYIHQSSSLIHGNLKSSNVLLGGDFEACLTDYGLAFFADTSANEDPDSAGYKAPEIRKSSRRATSKSDVYAFGILLLELLTGKHPSQHPLLVPTDVPDWVRVMRDDDVGDDNQLGMLTEVACICSLTSPEQRPAMWQVLKMIQEIKESVMT

HMMSmart: SM00219
IPR020635
404-660 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

RASAELLGRGSIGTTYKAVLDNQLIVTVKRLDAGKTAITSGEAFEEHMDVVGGLRHPYLVPVRAYFQAKGERLVIYDYQPNGSLFNLIHGSKSTRARPLHWTSCLKIAEDVAQGLAYIHQSSSLIHGNLKSSNVLLGGDFEACLTDYGLAFFADTSANEDPDSAGYKAPEIRKSSRRATSKSDVYAFGILLLELLTGKHPSQHPLLVPTDVPDWVRVMRDDDVGDDNQLGMLTEVACICSLTSPEQRPAMWQVLKMI

HMMPfam: PF00069
IPR017442
408-607 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

ELLGRGSIGTTYKAVLDNQLIVTVKRLDAGKTAITSGEAFEEHMDVVGGLRHPYLVPVRAYFQAKGERLVIYDYQPNGSLFNLIHGSKSTRARPLHWTSCLKIAEDVAQGLAYIHQSSSLIHGNLKSSNVLLGGDFEACLTDYGLAFFADTSANEDPDSAGYKAPEIRKSSRRATSKSDVYAFGILLLELLTGKHPSQHP

Gene3D: G3DSA:3.30.200.20
410-481 no description

LGRGSIGTTYKAVLDNQLIVTVKRLDAGKTAITSGEAFEEHMDVVGGLRHPYLVPVRAYFQAKGERLVIYDY

Gene3D: G3DSA:1.10.510.10
482-671 no description

QPNGSLFNLIHGSKSTRARPLHWTSCLKIAEDVAQGLAYIHQSSSLIHGNLKSSNVLLGGDFEACLTDYGLAFFADTSANEDPDSAGYKAPEIRKSSRRATSKSDVYAFGILLLELLTGKHPSQHPLLVPTDVPDWVRVMRDDDVGDDNQLGMLTEVACICSLTSPEQRPAMWQVLKMIQEIKESVMTDD

Seg: seg
613-629 seg

DVPDWVRVMRDDDVGDD






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox