PRGDB00070992 (Mdo.22363)

From PRG Wiki
Jump to: navigation, search
Mdo.22363
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 226741612 (GO497471)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR
Gene Species Malus x domestica

Comment?

NP_175748.1| receptor-related serine

DNA Sequence

ATCGAATTCCGTTGCTGTCGTGATTCTGCAAGAAAGATTGGAGAAGGTGGTTTTGGTCCTGTCTACAAGGGTCACTTACCTAACGGTTCATTGATAGCAGTTAAGCAGCTCTCATCCAATTCAAAGCAGGGAAATCGCGAATTTTTAAATGAGATTGGCATGATAACTTGTTTGCAACACCCGAATCTAGTGACACTGCATGGATGCTGTATTGAAAGGGATCAATTATTACTGGTTTACGAATACATGGAAAACAATAGTCTTGCGCATGCCTTATTCGGCCTGGAGAACAAAGTTAAACTGGACTGGCCTACACGGCTTAAGATTTGTACCGGTATAGCCAGAGGTTTAGCTTTTCTGCATGAAGAATCAAGACTCAAGATTGTTCACAGGGACATAAAAGCTACCAATGTGCTGCTGGATGGGGATTTGAACCCTAAAATATCGGACTTTGGATTGGCTAAACTTTATGGTGAAGAGAGCACACATGTCAGCACCAAAGTTGCAGGAACCATAGGATATATGGCACCAAAATATGCTCTATGGGGTCACTTGACCTACATGGCAGATGTTTACAGTTTCGGAGTTGTCGCGTTGGAGATTTCCAGTGGGAAGAAGAACAGTTATGTACCAAGTAACACTTGTGTCTGTCTCCTAGACTGGGCCTATCAGTTGCAACAAGGTGGAAATTTGAAGGAGCTG


Protein sequences

Name Description Sequence
Mdo.22363 translated coding region predicted by ESTScan from UniGene Mdo.22363

IEFRCCRDSARKIGEGGFGPVYKGHLPNGSLIAVKQLSSNSKQGNREFLNEIGMITCLQHPNLVTLHGCCIERDQLLLVYEYMENNSLAHALFGLENKVKLDWPTRLKICTGIARGLAFLHEESRLKIVHRDIKATNVLLDGDLNPKISDFGLAKLYGEESTHVSTKVAGTIGYMAPKYALWGHLTYMADVYSFGVVALEISSGKKNSYVPSNTCVCLLDWAYQLQQGGNLKEL

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
7-234 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

RDSARKIGEGGFGPVYKGHLPNGSLIAVKQLSSNSKQGNREFLNEIGMITCLQHPNLVTLHGCCIERDQLLLVYEYMENNSLAHALFGLENKVKLDWPTRLKICTGIARGLAFLHEESRLKIVHRDIKATNVLLDGDLNPKISDFGLAKLYGEESTHVSTKVAGTIGYMAPKYALWGHLTYMADVYSFGVVALEISSGKKNSYVPSNTCVCLLDWAYQLQQGGNLKEL

HMMSmart: SM00219
IPR020635
7-234 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

RDSARKIGEGGFGPVYKGHLPNGSLIAVKQLSSNSKQGNREFLNEIGMITCLQHPNLVTLHGCCIERDQLLLVYEYMENNSLAHALFGLENKVKLDWPTRLKICTGIARGLAFLHEESRLKIVHRDIKATNVLLDGDLNPKISDFGLAKLYGEESTHVSTKVAGTIGYMAPKYALWGHLTYMADVYSFGVVALEISSGKKNSYVPSNTCVCLLDWAYQLQQGGNLKEL

HMMSmart: SM00220
IPR002290
7-234 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

RDSARKIGEGGFGPVYKGHLPNGSLIAVKQLSSNSKQGNREFLNEIGMITCLQHPNLVTLHGCCIERDQLLLVYEYMENNSLAHALFGLENKVKLDWPTRLKICTGIARGLAFLHEESRLKIVHRDIKATNVLLDGDLNPKISDFGLAKLYGEESTHVSTKVAGTIGYMAPKYALWGHLTYMADVYSFGVVALEISSGKKNSYVPSNTCVCLLDWAYQLQQGGNLKEL

Gene3D: G3DSA:3.30.200.20
10-69 no description

ARKIGEGGFGPVYKGHLPNGSLIAVKQLSSNSKQGNREFLNEIGMITCLQHPNLVTLHGC

superfamily: SSF56112
IPR011009
11-206 Protein kinase-like (PK-like)
Protein kinase-like domain

RKIGEGGFGPVYKGHLPNGSLIAVKQLSSNSKQGNREFLNEIGMITCLQHPNLVTLHGCCIERDQLLLVYEYMENNSLAHALFGLENKVKLDWPTRLKICTGIARGLAFLHEESRLKIVHRDIKATNVLLDGDLNPKISDFGLAKLYGEESTHVSTKVAGTIGYMAPKYALWGHLTYMADVYSFGVVALEISSGKK

HMMPfam: PF00069
IPR017442
11-205 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

RKIGEGGFGPVYKGHLPNGSLIAVKQLSSNSKQGNREFLNEIGMITCLQHPNLVTLHGCCIERDQLLLVYEYMENNSLAHALFGLENKVKLDWPTRLKICTGIARGLAFLHEESRLKIVHRDIKATNVLLDGDLNPKISDFGLAKLYGEESTHVSTKVAGTIGYMAPKYALWGHLTYMADVYSFGVVALEISSGK

HMMPanther: PTHR24420:SF699
12-234 LEUCINE-RICH REPEAT FAMILY PROTEIN / PROTEIN KINASE FAMILY PROTEIN

KIGEGGFGPVYKGHLPNGSLIAVKQLSSNSKQGNREFLNEIGMITCLQHPNLVTLHGCCIERDQLLLVYEYMENNSLAHALFGLENKVKLDWPTRLKICTGIARGLAFLHEESRLKIVHRDIKATNVLLDGDLNPKISDFGLAKLYGEESTHVSTKVAGTIGYMAPKYALWGHLTYMADVYSFGVVALEISSGKKNSYVPSNTCVCLLDWAYQLQQGGNLKEL

HMMPanther: PTHR24420
12-234 FAMILY NOT NAMED,FAMILY NOT NAMED

KIGEGGFGPVYKGHLPNGSLIAVKQLSSNSKQGNREFLNEIGMITCLQHPNLVTLHGCCIERDQLLLVYEYMENNSLAHALFGLENKVKLDWPTRLKICTGIARGLAFLHEESRLKIVHRDIKATNVLLDGDLNPKISDFGLAKLYGEESTHVSTKVAGTIGYMAPKYALWGHLTYMADVYSFGVVALEISSGKKNSYVPSNTCVCLLDWAYQLQQGGNLKEL

Gene3D: G3DSA:1.10.510.10
70-206 no description

CIERDQLLLVYEYMENNSLAHALFGLENKVKLDWPTRLKICTGIARGLAFLHEESRLKIVHRDIKATNVLLDGDLNPKISDFGLAKLYGEESTHVSTKVAGTIGYMAPKYALWGHLTYMADVYSFGVVALEISSGKK

PatternScan: PS00108
IPR008271
128-140 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDIKATNVLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox