PRGDB00071011 (Mdo.24061)

From PRG Wiki
Jump to: navigation, search
Mdo.24061
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 51561289 (CV082428)
Gene Class CNL
Domain Type NBS, LRR
Gene Species Malus x domestica

Comment?

Mdst6001k19.y1 Mdst Malus x domestica cDNA clone Mdst6001k19 5' similar to TR:Q9SZA7 Q9SZA7 HYPOTHETICAL 96.2 KD PROTEIN. ;, mRNA sequence

DNA Sequence

CGTTGCTGTCGAGGGTTTTCAACTAAATGGCACAAAATGCAAATGCCAGAAGTTGAGGTTTTAGTATTGAATTTCCAGACAAAGAACTATGGTTTACCCGAATCTGTGGTGAACATGGATGAATTGAAGGCTGTGATAGTCACAAATTATGGTTTCTTACCTGCTGAATTGAGTAACTTCCAACTTTTAAGTTCGTTACCAAATCTTAAGAGAATCAGATTAGAACGCATCTCAATTCTTTCCATAACCAAGAATCCCATACAATTGGCGAGTCTGAAGAAGATATCCTTGTTCATGTGTAATATTGGTCAAGCTTTCAATAACTGTTCCATCTCAATCTCATCAGCATTCCCGAATCTAGAGGAAATGAACATCGACTATTGCAGTGATTTAATTGAATTACCCGCCGAGGTTTGTGATCTTAGTAAACTAAGGAAGCTCAGTGTCACCAACTGTCATAAGCTATCTGCCTTGCCTGAAGGGATTGGAAAGTTGGAAAATTTAGAATTGTTGAGGCTAAGATCCTGCACAGAACTGTCAAAGCTTCCAACCTCGATGAAGAACCTTGGAAAGGTAAACTTTCTTGATATATCTGATTGCTTCAGCATCAAGGTGTTGCCCGAAGACATTGGTGAAATGAGTAGTTTAAGAAAGATCAACATGAGGCAATGCTCAAGGTTGCAAGAGCTACCTCCATCAGTCATGGATCTTGAGCAGTTAGAGGAAGTGGTCTGTGATGAAAAGACAAAAGATTTATGGGAA


Protein sequences

Name Description Sequence
Mdo.24061 translated coding region predicted by ESTScan from UniGene Mdo.24061

RCCRGFSTKWHKMQMPEVEVLVLNFQTKNYGLPESVVNMDELKAVIVTNYGFLPAELSNFQLLSSLPNLKRIRLERISILSITKNPIQLASLKKISLFMCNIGQAFNNCSISISSAFPNLEEMNIDYCSDLIELPAEVCDLSKLRKLSVTNCHKLSALPEGIGKLENLELLRLRSCTELSKLPTSMKNLGKVNFLDISDCFSIKVLPEDIGEMSSLRKINMRQCSRLQELPPSVMDLEQLEEVVCDEKTKDLWE


Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.80.10.10
16-243 no description

PEVEVLVLNFQTKNYGLPESVVNMDELKAVIVTNYGFLPAELSNFQLLSSLPNLKRIRLERISILSITKNPIQLASLKKISLFMCNIGQAFNNCSISISSAFPNLEEMNIDYCSDLIELPAEVCDLSKLRKLSVTNCHKLSALPEGIGKLENLELLRLRSCTELSKLPTSMKNLGKVNFLDISDCFSIKVLPEDIGEMSSLRKINMRQCSRLQELPPSVMDLEQLEEV

superfamily: SSF52047
31-242 RNI-like,LRR

GLPESVVNMDELKAVIVTNYGFLPAELSNFQLLSSLPNLKRIRLERISILSITKNPIQLASLKKISLFMCNIGQAFNNCSISISSAFPNLEEMNIDYCSDLIELPAEVCDLSKLRKLSVTNCHKLSALPEGIGKLENLELLRLRSCTELSKLPTSMKNLGKVNFLDISDCFSIKVLPEDIGEMSSLRKINMRQCSRLQELPPSVMDLEQLEE

HMMPanther: PTHR23155:SF239
32-241 DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS), PUTATIVE,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

LPESVVNMDELKAVIVTNYGFLPAELSNFQLLSSLPNLKRIRLERISILSITKNPIQLASLKKISLFMCNIGQAFNNCSISISSAFPNLEEMNIDYCSDLIELPAEVCDLSKLRKLSVTNCHKLSALPEGIGKLENLELLRLRSCTELSKLPTSMKNLGKVNFLDISDCFSIKVLPEDIGEMSSLRKINMRQCSRLQELPPSVMDLEQLE

HMMPanther: PTHR23155
32-241 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LPESVVNMDELKAVIVTNYGFLPAELSNFQLLSSLPNLKRIRLERISILSITKNPIQLASLKKISLFMCNIGQAFNNCSISISSAFPNLEEMNIDYCSDLIELPAEVCDLSKLRKLSVTNCHKLSALPEGIGKLENLELLRLRSCTELSKLPTSMKNLGKVNFLDISDCFSIKVLPEDIGEMSSLRKINMRQCSRLQELPPSVMDLEQLE

Seg: seg
71-82 seg

RIRLERISILSI

HMMPfam: PF00560
IPR001611
215-233 LRR_1
Leucine-rich repeat

SLRKINMRQCSRLQELPPS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox