PRGDB00071013 (Mdo.24089)

From PRG Wiki
Jump to: navigation, search
Mdo.24089
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 226754669 (GO509308)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Malus x domestica

Comment?

BAB63697.1| putative serine

DNA Sequence

TATTTAATTCCGTTGCTGTCGAACCCCTTTTTGGGCTTTCAACCACTTCCGTGGAACCTTCGTATGAGGATTGCCCTTGGTGCTGCTAAGGGTCTAGCATTCCTTAGCAGTGATCTGCAAGTGATTTATCGTGACTTCAAAACTTCTGATATCCTGCTGGATTCGATGAACAATGCTAAACTTTCAAATTTTGGTCTGGCCTGGGGTTGGCCAGCCGGTGATAAAACCCATGTCTCATCAAGGGTCTTGGGGACATATGGGTATGCAGCTCCTGAGTATATAGCCACAGGTCAATTAACTGCCAAAAGTAATGTGTATAGTTTTGGAGTTGTTCTGCTCGAAATGGTGTCTGGCAGACCAGTTGTGGACAAGAATCGGCCATCCGGAGAACACAATTTAGTTGAATGGGCCAAGCCTTACCTTGCCAGCAAACGCAAAGTTTTCAAAATTTTTGATGCTCGAATTGAAGGTCAGTACTCTTTGAGTGACGCTCTCAAAGTAGTTAATCTAGCAATTCACTGCTTAGCAGCAGACCCCAAGTCTAGGCCAAACATGAACGACGTGGTAATAACATTGGAGCAGCTTCAGAAAAGTGAACCTTC


Protein sequences

Name Description Sequence
Mdo.24089 translated coding region predicted by ESTScan from UniGene Mdo.24089

YLIPLLSNPFLGFQPLPWNLRMRIALGAAKGLAFLSSDLQVIYRDFKTSDILLDSMNNAKLSNFGLAWGWPAGDKTHVSSRVLGTYGYAAPEYIATGQLTAKSNVYSFGVVLLEMVSGRPVVDKNRPSGEHNLVEWAKPYLASKRKVFKIFDARIEGQYSLSDALKVVNLAIHCLAADPKSRPNMNDVVITLEQLQKSEPS

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-195 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YLIPLLSNPFLGFQPLPWNLRMRIALGAAKGLAFLSSDLQVIYRDFKTSDILLDSMNNAKLSNFGLAWGWPAGDKTHVSSRVLGTYGYAAPEYIATGQLTAKSNVYSFGVVLLEMVSGRPVVDKNRPSGEHNLVEWAKPYLASKRKVFKIFDARIEGQYSLSDALKVVNLAIHCLAADPKSRPNMNDVVITLEQL

HMMSmart: SM00220
IPR002290
1-195 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YLIPLLSNPFLGFQPLPWNLRMRIALGAAKGLAFLSSDLQVIYRDFKTSDILLDSMNNAKLSNFGLAWGWPAGDKTHVSSRVLGTYGYAAPEYIATGQLTAKSNVYSFGVVLLEMVSGRPVVDKNRPSGEHNLVEWAKPYLASKRKVFKIFDARIEGQYSLSDALKVVNLAIHCLAADPKSRPNMNDVVITLEQL

HMMPanther: PTHR24420:SF861
13-199 SUBFAMILY NOT NAMED

FQPLPWNLRMRIALGAAKGLAFLSSDLQVIYRDFKTSDILLDSMNNAKLSNFGLAWGWPAGDKTHVSSRVLGTYGYAAPEYIATGQLTAKSNVYSFGVVLLEMVSGRPVVDKNRPSGEHNLVEWAKPYLASKRKVFKIFDARIEGQYSLSDALKVVNLAIHCLAADPKSRPNMNDVVITLEQLQKSE

HMMPanther: PTHR24420
13-199 FAMILY NOT NAMED,FAMILY NOT NAMED

FQPLPWNLRMRIALGAAKGLAFLSSDLQVIYRDFKTSDILLDSMNNAKLSNFGLAWGWPAGDKTHVSSRVLGTYGYAAPEYIATGQLTAKSNVYSFGVVLLEMVSGRPVVDKNRPSGEHNLVEWAKPYLASKRKVFKIFDARIEGQYSLSDALKVVNLAIHCLAADPKSRPNMNDVVITLEQLQKSE

Gene3D: G3DSA:1.10.510.10
14-189 no description

QPLPWNLRMRIALGAAKGLAFLSSDLQVIYRDFKTSDILLDSMNNAKLSNFGLAWGWPAGDKTHVSSRVLGTYGYAAPEYIATGQLTAKSNVYSFGVVLLEMVSGRPVVDKNRPSGEHNLVEWAKPYLASKRKVFKIFDARIEGQYSLSDALKVVNLAIHCLAADPKSRPNMNDVV

superfamily: SSF56112
IPR011009
14-200 Protein kinase-like (PK-like)
Protein kinase-like domain

QPLPWNLRMRIALGAAKGLAFLSSDLQVIYRDFKTSDILLDSMNNAKLSNFGLAWGWPAGDKTHVSSRVLGTYGYAAPEYIATGQLTAKSNVYSFGVVLLEMVSGRPVVDKNRPSGEHNLVEWAKPYLASKRKVFKIFDARIEGQYSLSDALKVVNLAIHCLAADPKSRPNMNDVVITLEQLQKSEP

HMMPfam: PF00069
IPR017442
16-188 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

LPWNLRMRIALGAAKGLAFLSSDLQVIYRDFKTSDILLDSMNNAKLSNFGLAWGWPAGDKTHVSSRVLGTYGYAAPEYIATGQLTAKSNVYSFGVVLLEMVSGRPVVDKNRPSGEHNLVEWAKPYLASKRKVFKIFDARIEGQYSLSDALKVVNLAIHCLAADPKSRPNMNDV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox