PRGDB00071015 (Mdo.24135)

From PRG Wiki
Jump to: navigation, search
Mdo.24135
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 91045347 (EB155765)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Malus x domestica

Comment?

030121ABLC002329HT (ABLC) Braeburn cell culture three days after subculture Malus x domestica cDNA clone ABLC002329, mRNA sequence

DNA Sequence

TGCTAATGTTAGAGAGGTGTGCTCTAAGGATGGTATAGTTCATCTACAAAAGCAGCTTCTTTCTGAAATCTTAGGGGAAAATAACATACAAATTTGGAATGCTTATAGTGGAATCACTAGGATAAGTAGGTGTTTATGTAATAAAAAGGTTCTTCTCGTACTCGACGATGTGGATCAATTAGACCAACTGGAAAAGTTGGTCAAACAAAAAGAGTGGTTTGGTTTTGGGAGTAGAGTCGTCGTTACAACTAGAGATGAACGTTTGTTAGTTGAACATGGTATAGAGATGGTATATGAGGTTAAGCCTTTAACCCAAGATGAAGCTCTTTTTCTCTTTAGTCGGAAAGCCTTTAAAGATGATGAGTTGGAAGAAGATTTTTTAGAACTGTCTAAATGTTTCATCAATTATGCAAGTGGTCTTCCATTAGCTCTTAAAACTTTAGGGTCTTTTTTGTACAAAAGAGGTCGAGATGAATGGAAGAGTGCACTAGATAAACTGAAGCAAGCTCCTGATAGGAAAATTTTTGAAACATTGAAAATAAGTTATGATGGACTAGAAGAGTTTTATAAGAGAATCTTCCTTGACATTGCATGTTTCCATAAGTCTTGTGAAAAGGAGCGAGTAATTGAAGGACTAGAAAACTGTGGTTTTGTTGGCGCTCGCGTTGTGATTGAAGTTCTTATTGAGAAATCTCTCTTGGATATTTCATTCAATTCTCTGTCTATGCATGATTTGAT


Protein sequences

Name Description Sequence
Mdo.24135 translated coding region predicted by ESTScan from UniGene Mdo.24135

XANVREVCSKDGIVHLQKQLLSEILGENNIQIWNAYSGITRISRCLCNKKVLLVLDDVDQLDQLEKLVKQKEWFGFGSRVVVTTRDERLLVEHGIEMVYEVKPLTQDEALFLFSRKAFKDDELEEDFLELSKCFINYASGLPLALKTLGSFLYKRGRDEWKSALDKLKQAPDRKIFETLKISYDGLEEFYKRIFLDIACFHKSCEKERVIEGLENCGFVGARVVIEVLIEKSLLDISFNSLSMHDLX

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
4-175 P-loop containing nucleoside triphosphate hydrolases

VREVCSKDGIVHLQKQLLSEILGENNIQIWNAYSGITRISRCLCNKKVLLVLDDVDQLDQLEKLVKQKEWFGFGSRVVVTTRDERLLVEHGIEMVYEVKPLTQDEALFLFSRKAFKDDELEEDFLELSKCFINYASGLPLALKTLGSFLYKRGRDEWKSALDKLKQAPDRKI

HMMPfam: PF00931
IPR002182
10-221 NB-ARC,NBS
NB-ARC

KDGIVHLQKQLLSEILGENNIQIWNAYSGITRISRCLCNKKVLLVLDDVDQLDQLEKLVKQKEWFGFGSRVVVTTRDERLLVEHGIEMVYEVKPLTQDEALFLFSRKAFKDDELEEDFLELSKCFINYASGLPLALKTLGSFLYKRGRDEWKSALDKLKQAPDRKIFETLKISYDGLEEFYKRIFLDIACFHKSCEKERVIEGLENCGFVGA

HMMPanther: PTHR11017:SF20
15-246 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

HLQKQLLSEILGENNIQIWNAYSGITRISRCLCNKKVLLVLDDVDQLDQLEKLVKQKEWFGFGSRVVVTTRDERLLVEHGIEMVYEVKPLTQDEALFLFSRKAFKDDELEEDFLELSKCFINYASGLPLALKTLGSFLYKRGRDEWKSALDKLKQAPDRKIFETLKISYDGLEEFYKRIFLDIACFHKSCEKERVIEGLENCGFVGARVVIEVLIEKSLLDISFNSLSMHDL

HMMPanther: PTHR11017
15-246 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

HLQKQLLSEILGENNIQIWNAYSGITRISRCLCNKKVLLVLDDVDQLDQLEKLVKQKEWFGFGSRVVVTTRDERLLVEHGIEMVYEVKPLTQDEALFLFSRKAFKDDELEEDFLELSKCFINYASGLPLALKTLGSFLYKRGRDEWKSALDKLKQAPDRKIFETLKISYDGLEEFYKRIFLDIACFHKSCEKERVIEGLENCGFVGARVVIEVLIEKSLLDISFNSLSMHDL

FPrintScan: PR00364
IPR000767
45-59 DISEASERSIST
Disease resistance protein

CLCNKKVLLVLDDVD

Seg: seg
49-68 seg

KKVLLVLDDVDQLDQLEKLV

Seg: seg
120-130 seg

DDELEEDFLEL

FPrintScan: PR00364
IPR000767
138-152 DISEASERSIST
Disease resistance protein

ASGLPLALKTLGSFL

FPrintScan: PR00364
IPR000767
236-247 DISEASERSIST
Disease resistance protein

ISFNSLSMHDLX






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox