PRGDB00071018 (Mdo.24266)

From PRG Wiki
Jump to: navigation, search
Mdo.24266
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 71822862 (DT000254)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Malus x domestica

Comment?

AAG16628.1| protein serine

DNA Sequence

CACGAGGCTCCTGTTCTACACAGAAATTTGAAATGCTCCAATATTTTGCTTGGTGAAGGGTATCATCCAAAGCTGTCTGGTTTTGGCTTAGCCAAACTTGGGCCTGCTGGGGATAACACCCATGTATCTAAATGGGTAATGGGAACGTATGGATATTGTGCTCCAGAGTATGCAATGACAGGGCAGTTGACTCTTAAATCAGACATTTATAGCTTTGGTGTAGTTCTTTTGGAAATTATAACAGGCAGGACAGCGATTGACAATACCAGAGGTGCAGGAGAACAGATTTTGGTTGAGTGGGCAAGAACCTTGTTTAAAGACCGAAGGAAACTTTCGCAAATGGCAGACCCAACGCTCCAGGGTCAGTATCCCAAAAGGGGGTTGTACCAAGCTCTTGCAGTTGCGGGAATGTGTGTTCAGGAGCAGCCTAATATGCGGCCAGTTATAGCTGATGTCGTCACAGCTTTGACTTACCTTGCTTCACAGAAGTATGACCATGAAACAGAGCCAGTCCAAAGCTCCCGTCTTGCCCCTTGTACTCCCCCTAGAACCAAGAGGGATATTGAAAAGGAAGCTCAATTGTGGTAGTGGACACGCCAACCATCGCAATGTTATGATAGTATCTGATAGATGCTCATACGGTATGGAGTCTGAACTGATATTGATCGTGGATGATAACATGCCATCAGATCCTAATTCTGAAA


Protein sequences

Name Description Sequence
Mdo.24266 translated coding region predicted by ESTScan from UniGene Mdo.24266

HEAPVLHRNLKCSNILLGEGYHPKLSGFGLAKLGPAGDNTHVSKWVMGTYGYCAPEYAMTGQLTLKSDIYSFGVVLLEIITGRTAIDNTRGAGEQILVEWARTLFKDRRKLSQMADPTLQGQYPKRGLYQALAVAGMCVQEQPNMRPVIADVVTALTYLASQKYDHETEPVQSSRLAPCTPPRTKRDIEKEAHCGSGHANHRNVMIVSDRCSYGMESELILIVDDNMPSDPNSEX

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-159 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

HEAPVLHRNLKCSNILLGEGYHPKLSGFGLAKLGPAGDNTHVSKWVMGTYGYCAPEYAMTGQLTLKSDIYSFGVVLLEIITGRTAIDNTRGAGEQILVEWARTLFKDRRKLSQMADPTLQGQYPKRGLYQALAVAGMCVQEQPNMRPVIADVVTALTYL

HMMPfam: PF00069
IPR017442
1-153 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

HEAPVLHRNLKCSNILLGEGYHPKLSGFGLAKLGPAGDNTHVSKWVMGTYGYCAPEYAMTGQLTLKSDIYSFGVVLLEIITGRTAIDNTRGAGEQILVEWARTLFKDRRKLSQMADPTLQGQYPKRGLYQALAVAGMCVQEQPNMRPVIADVV

Gene3D: G3DSA:1.10.510.10
1-155 no description

HEAPVLHRNLKCSNILLGEGYHPKLSGFGLAKLGPAGDNTHVSKWVMGTYGYCAPEYAMTGQLTLKSDIYSFGVVLLEIITGRTAIDNTRGAGEQILVEWARTLFKDRRKLSQMADPTLQGQYPKRGLYQALAVAGMCVQEQPNMRPVIADVVTA

superfamily: SSF56112
IPR011009
1-156 Protein kinase-like (PK-like)
Protein kinase-like domain

HEAPVLHRNLKCSNILLGEGYHPKLSGFGLAKLGPAGDNTHVSKWVMGTYGYCAPEYAMTGQLTLKSDIYSFGVVLLEIITGRTAIDNTRGAGEQILVEWARTLFKDRRKLSQMADPTLQGQYPKRGLYQALAVAGMCVQEQPNMRPVIADVVTAL

HMMPanther: PTHR24420:SF799
4-227 SUBFAMILY NOT NAMED

PVLHRNLKCSNILLGEGYHPKLSGFGLAKLGPAGDNTHVSKWVMGTYGYCAPEYAMTGQLTLKSDIYSFGVVLLEIITGRTAIDNTRGAGEQILVEWARTLFKDRRKLSQMADPTLQGQYPKRGLYQALAVAGMCVQEQPNMRPVIADVVTALTYLASQKYDHETEPVQSSRLAPCTPPRTKRDIEKEAHCGSGHANHRNVMIVSDRCSYGMESELILIVDDNM

HMMPanther: PTHR24420
4-227 FAMILY NOT NAMED,FAMILY NOT NAMED

PVLHRNLKCSNILLGEGYHPKLSGFGLAKLGPAGDNTHVSKWVMGTYGYCAPEYAMTGQLTLKSDIYSFGVVLLEIITGRTAIDNTRGAGEQILVEWARTLFKDRRKLSQMADPTLQGQYPKRGLYQALAVAGMCVQEQPNMRPVIADVVTALTYLASQKYDHETEPVQSSRLAPCTPPRTKRDIEKEAHCGSGHANHRNVMIVSDRCSYGMESELILIVDDNM






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox