PRGDB00071021 (Mdo.24556)

From PRG Wiki
Jump to: navigation, search
Mdo.24556
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 226782724 (GO539362)
Gene Class Unknown
Domain Type
Gene Species Malus x domestica

Comment?

NP_176867.2| ABC transporter family protein [Arabidopsis thaliana] tpg|DAA00879.1| TPA: PDR11 ABC transporter [Arabidopsis thaliana], mRNA sequence

DNA Sequence

CGAATTCCGTTGCTGTCGCTGATCTCTATAGGAGAAACCAGGAACTTATCAAGGAACTAAGCACGCCACAACCAGGCTCTAAGGATCTTCACTTCCCCACCCAATTTTCCCAAAGCTTTTTAACTCAGTGCCAAGCATGCTTCTGGAAACAGCATTGGTCATACTGGAGGAACTCGCAGTACAATGCCATTAGGTTTTTCATGACAATTTCCGTTGGAGTTATATTTGGTATTATCTTCTGGAACAAAGGAAAGAAAATGGATACACAACAAGACATCATGAATCTGTTGGGGGCAGGATATGCTGCTGTTCTTTTCCTTGGAGCGGGCAATGCTTCTGCTGTGCAATCGGTTGTTGCTGTTGAACGAACAGTTTTCTACCGTGAAAGAGCTGCTGGGATGTATTCTGAGTTGCCTTATGCATTTTCTCAGGTGGCTATTGAGACACTTTACGTTTTAATCCAAACCTTTGCGTATTCCGTTATTTTGTATGGCATGATTGGGTTCGATTGGAAGGTGGACAAATTTTTGTACTTCTACTATTTCATATTCATGTGCTTCACATATTTCTCCATGTACGGGATGATGGCAGTTGCCCTAACTCCTGGTCCCCAAATTGCTGCAATTGTTATGGGCTTCTTCATGAGCTTCTGGAACTTGTTCTCTGGTTT


Protein sequences

Name Description Sequence
Mdo.24556 translated coding region predicted by ESTScan from UniGene Mdo.24556

XNSVAVADLYRRNQELIKELSTPQPGSKDLHFPTQFSQSFLTQCQACFWKQHWSYWRNSQYNAIRFFMTISVGVIFGIIFWNKGKKMDTQQDIMNLLGAGYAAVLFLGAGNASAVQSVVAVERTVFYRERAAGMYSELPYAFSQVAIETLYVLIQTFAYSVILYGMIGFDWKVDKFLYFYYFIFMCFTYFSMYGMMAVALTPGPQIAAIVMGFFMSFWNLFSGX


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR19241:SF10
8-223 ATP-BINDING CASSETTE TRANSPORTER (PDR),ATP-BINDING CASSETTE TRANSPORTER (PDR)

DLYRRNQELIKELSTPQPGSKDLHFPTQFSQSFLTQCQACFWKQHWSYWRNSQYNAIRFFMTISVGVIFGIIFWNKGKKMDTQQDIMNLLGAGYAAVLFLGAGNASAVQSVVAVERTVFYRERAAGMYSELPYAFSQVAIETLYVLIQTFAYSVILYGMIGFDWKVDKFLYFYYFIFMCFTYFSMYGMMAVALTPGPQIAAIVMGFFMSFWNLFSG

HMMPanther: PTHR19241
8-223 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

DLYRRNQELIKELSTPQPGSKDLHFPTQFSQSFLTQCQACFWKQHWSYWRNSQYNAIRFFMTISVGVIFGIIFWNKGKKMDTQQDIMNLLGAGYAAVLFLGAGNASAVQSVVAVERTVFYRERAAGMYSELPYAFSQVAIETLYVLIQTFAYSVILYGMIGFDWKVDKFLYFYYFIFMCFTYFSMYGMMAVALTPGPQIAAIVMGFFMSFWNLFSG

HMMPfam: PF01061
IPR013525
42-223 ABC2_membrane
ABC-2 type transporter

TQCQACFWKQHWSYWRNSQYNAIRFFMTISVGVIFGIIFWNKGKKMDTQQDIMNLLGAGYAAVLFLGAGNASAVQSVVAVERTVFYRERAAGMYSELPYAFSQVAIETLYVLIQTFAYSVILYGMIGFDWKVDKFLYFYYFIFMCFTYFSMYGMMAVALTPGPQIAAIVMGFFMSFWNLFSG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox