PRGDB00071022 (Mdo.24622)

From PRG Wiki
Jump to: navigation, search
Mdo.24622
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 52023770 (CV186503)
Gene Class CNL
Domain Type NBS, LRR
Gene Species Malus x domestica

Comment?

Mdlv2_4014b11.y1 Mdlv2 Malus x domestica cDNA clone Mdlv2_4014b11 5' similar to TR:Q9SZA7 Q9SZA7 HYPOTHETICAL 96.2 KD PROTEIN. ;, mRNA sequence

DNA Sequence

TTTAATCCAAGAAAATATAATACACATTATTTATGTTGTGTAAAACAATAACATGATGATTATACAAAAAAACAACACCACAAAATATCTTAAGACTCAAGAGAGTTTGAAATAAATAGTATTACAAAAACTCTTATGATGAAACATAGAAATTGGACAGAACCAAGAACGAAACATTTATTGAGAAAAACAATGCAACACAAATCAGAAACATGTTGCTCCAACATTTATTGAGGAAAGACAGGTCTCATAACTGAGGCTTTTCGAGCCAATTCAGACTGGATTTTTCTTTTGTCACCTTGATTTTGTCTCTGGCTAAGAAGGAATCCCAGAAAGGTTTCTTCTCTTCATCACAAATCACTTCCTCTAACTGCTCGTCAAGATCCCACACTGATAGAGGCAACTCCTCCAATCTTGAGCATTGTCCCATGTTGATCTTTCTTAAACCTCTCATCTTACCAATGCCTTCAGGCAACTTCCTAATGCCGAAACAATTATACATGTCAAGGCAGCGCAACTTAGTGAGGTTTTCAATTGAAACCGGAAGCCTTACCAACTCTGTACAGGACCTTAGTCTCAATACATCCAATTTCTTCAGATTTCCGATCTCTTCAGGCAAGCAAGATAGCTGATGGCAGTTGGTGATACTAAGCACCTTCATATGAACAAGATCACAGAGCTCGGCAGGCAGTTTCACCAAATCATCACAATAGTCGATATTCATTTCCTCTAGACCTGGCCAGGCATCAAAAATTTTGAATGGAACATTTTGGAAAGCTTGACCCATATT


Protein sequences

Name Description Sequence
Mdo.24622 translated coding region predicted by ESTScan from UniGene Mdo.24622

NMGQAFQNVPFKIFDAWPGLEEMNIDYCDDLVKLPAELCDLVHMKVLSITNCHQLSCLPEEIGNLKKLDVLRLRSCTELVRLPVSIENLTKLRCLDMYNCFGIRKLPEGIGKMRGLRKINMGQCSRLEELPLSVWDLDEQLEEVICDEEKKPFWDSFLARDKIKVTKEKSSLNWLEKPQL


Domains

Domain Start-End Description Sequence

superfamily: SSF52058
5-148 L domain-like,LRR

AFQNVPFKIFDAWPGLEEMNIDYCDDLVKLPAELCDLVHMKVLSITNCHQLSCLPEEIGNLKKLDVLRLRSCTELVRLPVSIENLTKLRCLDMYNCFGIRKLPEGIGKMRGLRKINMGQCSRLEELPLSVWDLDEQLEEVICDE

Gene3D: G3DSA:3.80.10.10
6-136 no description

FQNVPFKIFDAWPGLEEMNIDYCDDLVKLPAELCDLVHMKVLSITNCHQLSCLPEEIGNLKKLDVLRLRSCTELVRLPVSIENLTKLRCLDMYNCFGIRKLPEGIGKMRGLRKINMGQCSRLEELPLSVWD

HMMPanther: PTHR23155:SF239
20-139 DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS), PUTATIVE,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

LEEMNIDYCDDLVKLPAELCDLVHMKVLSITNCHQLSCLPEEIGNLKKLDVLRLRSCTELVRLPVSIENLTKLRCLDMYNCFGIRKLPEGIGKMRGLRKINMGQCSRLEELPLSVWDLDE

HMMPanther: PTHR23155
20-139 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LEEMNIDYCDDLVKLPAELCDLVHMKVLSITNCHQLSCLPEEIGNLKKLDVLRLRSCTELVRLPVSIENLTKLRCLDMYNCFGIRKLPEGIGKMRGLRKINMGQCSRLEELPLSVWDLDE

HMMPfam: PF00560
IPR001611
45-65 LRR_1
Leucine-rich repeat

KVLSITNCHQLSCLPEEIGNL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox