PRGDB00071023 (Mdo.24656)

From PRG Wiki
Jump to: navigation, search
Mdo.24656
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 46993490 (CN581940)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Malus x domestica

Comment?

Mdfw2034e19.y1 Mdfw Malus x domestica cDNA clone Mdfw2034e19 5' similar to TR:Q9SFN9 Q9SFN9 HYPOTHETICAL 112.2 KD PROTEIN. ;, mRNA sequence

DNA Sequence

TGCGATAACTCGCGCTCCAAATCTTTCCATTGTTACAGAATTTCTTCCAAGAGGTAGTTTATACAGGTTATTACACCGGCCTAACAATCAATTAGATGAGCGGAGGCGCTTGAGGATGGCTCTTGATGCTGCTCGCGGAATGAATTACTTGCATAACTGCACTCCAGTAATTGTACACCGTGATTTGAAGTCTCCAAATCTTCTTGTCGATAGGAACTGGGTAGTGAAGGTCTGTGATTTTGGATTATCACGAATGAAGAACAGCACATTTCTCTCCTCGAGGTCGACTGCAGGGACGGCTGAATGGATGGCTCCGGAAGTGCTAAGAAATGAACCTTCGGATGAAAAATGCGATGTTTATAGCTACGGGGTCATTTTATGGGAGCTCTCTACGATGCAACAGCCATGGGGAGGAATGAACCCAATGCAAGTTGTTGGTGCAGTTGGATTTCAACATCGCCGTCTTGATATTCCAGATAATATAGATCCTGCAATTGCAGATCTCATTCGAAAATGCTGGCAAACAGATCCAAAATTGAGACCGTCGTTTGCTGAGATCATGGCAATTCTGAAACCATTGCAGAAGCCGATAAGTAGAAGTGGACAGACCTAGTGCACAAGTA


Protein sequences

Name Description Sequence
Mdo.24656 translated coding region predicted by ESTScan from UniGene Mdo.24656

XAITRAPNLSIVTEFLPRGSLYRLLHRPNNQLDERRRLRMALDAARGMNYLHNCTPVIVHRDLKSPNLLVDRNWVVKVCDFGLSRMKNSTFLSSRSTAGTAEWMAPEVLRNEPSDEKCDVYSYGVILWELSTMQQPWGGMNPMQVVGAVGFQHRRLDIPDNIDPAIADLIRKCWQTDPKLRPSFAEIMAILKPLQKPISRSGQT

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-195 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XAITRAPNLSIVTEFLPRGSLYRLLHRPNNQLDERRRLRMALDAARGMNYLHNCTPVIVHRDLKSPNLLVDRNWVVKVCDFGLSRMKNSTFLSSRSTAGTAEWMAPEVLRNEPSDEKCDVYSYGVILWELSTMQQPWGGMNPMQVVGAVGFQHRRLDIPDNIDPAIADLIRKCWQTDPKLRPSFAEIMAILKPLQ

HMMSmart: SM00219
IPR020635
1-191 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

XAITRAPNLSIVTEFLPRGSLYRLLHRPNNQLDERRRLRMALDAARGMNYLHNCTPVIVHRDLKSPNLLVDRNWVVKVCDFGLSRMKNSTFLSSRSTAGTAEWMAPEVLRNEPSDEKCDVYSYGVILWELSTMQQPWGGMNPMQVVGAVGFQHRRLDIPDNIDPAIADLIRKCWQTDPKLRPSFAEIMAIL

HMMSmart: SM00220
IPR002290
1-199 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

XAITRAPNLSIVTEFLPRGSLYRLLHRPNNQLDERRRLRMALDAARGMNYLHNCTPVIVHRDLKSPNLLVDRNWVVKVCDFGLSRMKNSTFLSSRSTAGTAEWMAPEVLRNEPSDEKCDVYSYGVILWELSTMQQPWGGMNPMQVVGAVGFQHRRLDIPDNIDPAIADLIRKCWQTDPKLRPSFAEIMAILKPLQKPIS

HMMPanther: PTHR23257:SF80
2-196 MAP3K DELTA-1 PROTEIN KINASE,MAP3K DELTA-1 PROTEIN KINASE

AITRAPNLSIVTEFLPRGSLYRLLHRPNNQLDERRRLRMALDAARGMNYLHNCTPVIVHRDLKSPNLLVDRNWVVKVCDFGLSRMKNSTFLSSRSTAGTAEWMAPEVLRNEPSDEKCDVYSYGVILWELSTMQQPWGGMNPMQVVGAVGFQHRRLDIPDNIDPAIADLIRKCWQTDPKLRPSFAEIMAILKPLQK

HMMPanther: PTHR23257
2-196 FAMILY NOT NAMED,Ser-thr,SERINE-THREONINE PROTEIN KINASE

AITRAPNLSIVTEFLPRGSLYRLLHRPNNQLDERRRLRMALDAARGMNYLHNCTPVIVHRDLKSPNLLVDRNWVVKVCDFGLSRMKNSTFLSSRSTAGTAEWMAPEVLRNEPSDEKCDVYSYGVILWELSTMQQPWGGMNPMQVVGAVGFQHRRLDIPDNIDPAIADLIRKCWQTDPKLRPSFAEIMAILKPLQK

HMMPfam: PF07714
IPR001245
3-190 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

ITRAPNLSIVTEFLPRGSLYRLLHRPNNQLDERRRLRMALDAARGMNYLHNCTPVIVHRDLKSPNLLVDRNWVVKVCDFGLSRMKNSTFLSSRSTAGTAEWMAPEVLRNEPSDEKCDVYSYGVILWELSTMQQPWGGMNPMQVVGAVGFQHRRLDIPDNIDPAIADLIRKCWQTDPKLRPSFAEIMAI

superfamily: SSF56112
IPR011009
7-191 Protein kinase-like (PK-like)
Protein kinase-like domain

PNLSIVTEFLPRGSLYRLLHRPNNQLDERRRLRMALDAARGMNYLHNCTPVIVHRDLKSPNLLVDRNWVVKVCDFGLSRMKNSTFLSSRSTAGTAEWMAPEVLRNEPSDEKCDVYSYGVILWELSTMQQPWGGMNPMQVVGAVGFQHRRLDIPDNIDPAIADLIRKCWQTDPKLRPSFAEIMAIL

FPrintScan: PR00109
IPR001245
13-26 TYRKINASE
Serine-threonine/tyrosine-protein kinase

TEFLPRGSLYRLLH

Gene3D: G3DSA:1.10.510.10
18-195 no description

RGSLYRLLHRPNNQLDERRRLRMALDAARGMNYLHNCTPVIVHRDLKSPNLLVDRNWVVKVCDFGLSRMKNSTFLSSRSTAGTAEWMAPEVLRNEPSDEKCDVYSYGVILWELSTMQQPWGGMNPMQVVGAVGFQHRRLDIPDNIDPAIADLIRKCWQTDPKLRPSFAEIMAILKPLQ

Seg: seg
32-46 seg

LDERRRLRMALDAAR

FPrintScan: PR00109
IPR001245
52-70 TYRKINASE
Serine-threonine/tyrosine-protein kinase

HNCTPVIVHRDLKSPNLLV

PatternScan: PS00108
IPR008271
58-70 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDLKSPNLLV

FPrintScan: PR00109
IPR001245
99-109 TYRKINASE
Serine-threonine/tyrosine-protein kinase

GTAEWMAPEVL

FPrintScan: PR00109
IPR001245
118-140 TYRKINASE
Serine-threonine/tyrosine-protein kinase

CDVYSYGVILWELSTMQQPWGGM

Seg: seg
156-170 seg

LDIPDNIDPAIADLI

FPrintScan: PR00109
IPR001245
162-184 TYRKINASE
Serine-threonine/tyrosine-protein kinase

IDPAIADLIRKCWQTDPKLRPSF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox