PRGDB00071024 (Mdo.24657)

From PRG Wiki
Jump to: navigation, search
Mdo.24657
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 226747594 (GO503976)
Gene Class Unknown
Domain Type
Gene Species Malus x domestica

Comment?

AAG34696.1| NEC1 [Petunia x hybrida], mRNA sequence

DNA Sequence

TCGAATTCCGTTGCTGTCGAATATACAAGAAGAAATCATCGAAAGGGTTCCAATCCATACCTTACGTGGTTGCCCTACTCAGTGCAACTCTATTGTTGTATTATGGAGTCCTCAAGACAAATGCTTATTTGATCGTCAGCATCAACGCCATCGGAATCGTTATCGAAGTTACTTACCTCATCCTCTACATTGTATACGCATCCAAGAAGGACAAGATTACTACACTGAGTTTGATCCTGCTAGTAAATGTAGCCGCTTTCGGGTTGGTGCTGGCAGTCACCGTCTTCCTCCTTGGAGGGACAGCGCGCGTTTGCGCTGTTGGATGGATTTGTGCCGTGTTTAACATTGCTGTATTTGCTGCTCCTCTAAGCATTATGAGGCAAGTAATAAGAACCAAAAGTGTGGAATTCATGCCATTTTCTTTGTCCCTTTTCCTGACACTTTGTGCCACCATGTGGTTCTTCTACGGACTATTCACAAAGGATTACTACATTGCATTACCAAACGTGTTAGGGTTTCTATTTGGCATCGCCCAGATGATCCTATACATGACATACAAGAATTCAGGGAAAGATGTCGAAGTGAAAAAGAGTACTATGGAGATGAAGAAGTTGAGCTCCACCAACCGTCCAAATTTGACGGGCAGTGTGAACAAAAATTCAAGGTCAGATGAACTTAAGCAGACTACGGATGTCTATGAATCAAACGATGAACACGTATAGT


Protein sequences

Name Description Sequence
Mdo.24657 translated coding region predicted by ESTScan from UniGene Mdo.24657

XEFRCCRIYKKKSSKGFQSIPYVVALLSATLLLYYGVLKTNAYLIVSINAIGIVIEVTYLILYIVYASKKDKITTLSLILLVNVAAFGLVLAVTVFLLGGTARVCAVGWICAVFNIAVFAAPLSIMRQVIRTKSVEFMPFSLSLFLTLCATMWFFYGLFTKDYYIALPNVLGFLFGIAQMILYMTYKNSGKDVEVKKSTMEMKKLSSTNRPNLTGSVNKNSRSDELKQTTDVYESNDEHVXX


Domains

Domain Start-End Description Sequence

HMMPfam: PF03083
IPR004316
5-70 MtN3_slv
RAG1-activating protein-1-related

CCRIYKKKSSKGFQSIPYVVALLSATLLLYYGVLKTNAYLIVSINAIGIVIEVTYLILYIVYASKK

HMMPanther: PTHR10791:SF6
7-239 NODULIN MTN3-RELATED,NODULIN MTN3-RELATED

RIYKKKSSKGFQSIPYVVALLSATLLLYYGVLKTNAYLIVSINAIGIVIEVTYLILYIVYASKKDKITTLSLILLVNVAAFGLVLAVTVFLLGGTARVCAVGWICAVFNIAVFAAPLSIMRQVIRTKSVEFMPFSLSLFLTLCATMWFFYGLFTKDYYIALPNVLGFLFGIAQMILYMTYKNSGKDVEVKKSTMEMKKLSSTNRPNLTGSVNKNSRSDELKQTTDVYESNDEH

HMMPanther: PTHR10791
IPR004316
7-239 RAG1-ACTIVATING PROTEIN 1
RAG1-activating protein-1-related

RIYKKKSSKGFQSIPYVVALLSATLLLYYGVLKTNAYLIVSINAIGIVIEVTYLILYIVYASKKDKITTLSLILLVNVAAFGLVLAVTVFLLGGTARVCAVGWICAVFNIAVFAAPLSIMRQVIRTKSVEFMPFSLSLFLTLCATMWFFYGLFTKDYYIALPNVLGFLFGIAQMILYMTYKNSGKDVEVKKSTMEMKKLSSTNRPNLTGSVNKNSRSDELKQTTDVYESNDEH

HMMPfam: PF03083
IPR004316
107-189 MtN3_slv
RAG1-activating protein-1-related

VGWICAVFNIAVFAAPLSIMRQVIRTKSVEFMPFSLSLFLTLCATMWFFYGLFTKDYYIALPNVLGFLFGIAQMILYMTYKNS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox