PRGDB00071025 (Mdo.24685)

From PRG Wiki
Jump to: navigation, search
Mdo.24685
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 226758634 (GO513605)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Malus x domestica

Comment?

NP_181728.1| protein kinase, putative [Arabidopsis thaliana] pir|D84848 probable protein kinase [imported] - Arabidopsis thaliana gb|AAB63546.1| putative protein kinase [Arabidops>

DNA Sequence

CGAATTCCGTTGCTGTCGAGCAATGTCCTGCTCTTTGATGACCATGTTGCCAAAATTGCGGACTTCAATTTGTCAAATCAGTCATCGGACACGGCCGCGCGACTGCATTCGACTAGAGTGTTGGGAACGTTTGGCTATCATGCTCCTGAGTATGCGATGACAGGGCAAATTACTCAGAAAAGTGATGTTTACAGTTTTGGAGTTGTTTTACTAGAGCTTTTGACAGGAAGAAAGCCCGTAGACCATACAATGCCAAAGGGGCAACAAAGTCTTGTTACTTGGGCAACTCCAAGACTGAGTGAGGATAAAGTGAAGCAGTGTGTTGATCCCAAGCTAAACAATGACTACCCACCAAAGGCAATTGCTAAGTTGGCAGCAGTAGCAGCACTTTGTGTTCAATATGAAGCTGACTTCAGGCCAAACATGACGATCGTTGTGAAGGCTCTACAGCCACTGCTAAACGCAAAACCTGCAGGCCCAGAGACAAATGCTTAGACATATACTCTACCAAGTACCACATGCATGCATGCAGAATCAGCAACTTGTCTGGTGTACGTGTGATTTGTAACGTATCTTTCTTTTTTGTAATCCTATTCCTGCATTATGCTCCACTGAATCGATTGTCATTT


Protein sequences

Name Description Sequence
Mdo.24685 translated coding region predicted by ESTScan from UniGene Mdo.24685

RIPLLSSNVLLFDDHVAKIADFNLSNQSSDTAARLHSTRVLGTFGYHAPEYAMTGQITQKSDVYSFGVVLLELLTGRKPVDHTMPKGQQSLVTWATPRLSEDKVKQCVDPKLNNDYPPKAIAKLAAVAALCVQYEADFRPNMTIVVKALQPLLNAKPAGPETNA

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-153 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

RIPLLSSNVLLFDDHVAKIADFNLSNQSSDTAARLHSTRVLGTFGYHAPEYAMTGQITQKSDVYSFGVVLLELLTGRKPVDHTMPKGQQSLVTWATPRLSEDKVKQCVDPKLNNDYPPKAIAKLAAVAALCVQYEADFRPNMTIVVKALQPLL

HMMPfam: PF07714
IPR001245
5-149 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

LSSNVLLFDDHVAKIADFNLSNQSSDTAARLHSTRVLGTFGYHAPEYAMTGQITQKSDVYSFGVVLLELLTGRKPVDHTMPKGQQSLVTWATPRLSEDKVKQCVDPKLNNDYPPKAIAKLAAVAALCVQYEADFRPNMTIVVKAL

Gene3D: G3DSA:1.10.510.10
6-148 no description

SSNVLLFDDHVAKIADFNLSNQSSDTAARLHSTRVLGTFGYHAPEYAMTGQITQKSDVYSFGVVLLELLTGRKPVDHTMPKGQQSLVTWATPRLSEDKVKQCVDPKLNNDYPPKAIAKLAAVAALCVQYEADFRPNMTIVVKA

HMMPanther: PTHR24420:SF816
6-161 SUBFAMILY NOT NAMED

SSNVLLFDDHVAKIADFNLSNQSSDTAARLHSTRVLGTFGYHAPEYAMTGQITQKSDVYSFGVVLLELLTGRKPVDHTMPKGQQSLVTWATPRLSEDKVKQCVDPKLNNDYPPKAIAKLAAVAALCVQYEADFRPNMTIVVKALQPLLNAKPAGPE

HMMPanther: PTHR24420
6-161 FAMILY NOT NAMED,FAMILY NOT NAMED

SSNVLLFDDHVAKIADFNLSNQSSDTAARLHSTRVLGTFGYHAPEYAMTGQITQKSDVYSFGVVLLELLTGRKPVDHTMPKGQQSLVTWATPRLSEDKVKQCVDPKLNNDYPPKAIAKLAAVAALCVQYEADFRPNMTIVVKALQPLLNAKPAGPE

superfamily: SSF56112
IPR011009
6-149 Protein kinase-like (PK-like)
Protein kinase-like domain

SSNVLLFDDHVAKIADFNLSNQSSDTAARLHSTRVLGTFGYHAPEYAMTGQITQKSDVYSFGVVLLELLTGRKPVDHTMPKGQQSLVTWATPRLSEDKVKQCVDPKLNNDYPPKAIAKLAAVAALCVQYEADFRPNMTIVVKAL

Seg: seg
119-130 seg

KAIAKLAAVAAL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox