PRGDB00071026 (Mdo.24723)

From PRG Wiki
Jump to: navigation, search
Mdo.24723
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 71812460 (DR989851)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Malus x domestica

Comment?

NP_187165.2| protein kinase family [Arabidopsis thaliana] >gb|AAL91229.1| putative serine

DNA Sequence

CACGAGGAGAAAAGAAAACACTACATATTAATAGTCTTTCCCCTCACTCTCTCAGAACCACAATTTGAGCTGGTTGTGCTTTCAAATACCATGGAAATCCATCTACAACGACTCGATTCCCATGGGAATTGCAAGCACCCCAGAAACTGATAAGTCTACAAGAACCACTAGATTTAACATTGTTTAAATGTTCTATCTATCCACCTATTCAAGAACTGAAAGCGACCTGCTTGTGTCGGTTCAGATCGCCCAGATACTTAGTTGAATTATATTCTTGTGCATCTGATAGTTCTTCTGAGTATGTTCTTTGCAGAAACCTCCTTTTCGATTCTTTTGCACATTTGGATACATAATCATCGCCTCTTAGCAGCACCACAACCTGACTCATGCGAGGACGTAGAATAGAAGACTGCTCGATGCATAAAGCTGCTGTCAAAACCATGTGATCCATTTCTTTCCGGTCATAGTTGTCACCAATATTAGGATCGACAAGCTCCTTGATCTCATTGTTATCAAGCAAAGGCTTTGCCCAAAGTACAAGGCTTTTCTGAAGATCATCCAAAGCTGGACGCCCGGTTATAAGCTCCAGTAGTAGGACTCCGAAAGAATAAACATCAGTTTTTTCATCTACTATTCCATGCATGAAATACTCGGGAGCAAAATACCCAAATGTACCCTCAGATTTAGGGACAT


Protein sequences

Name Description Sequence
Mdo.24723 translated coding region predicted by ESTScan from UniGene Mdo.24723

XVPKSEGTFGYFAPEYFMHGIVDEKTDVYSFGVLLLELITGRPALDDLQKSLVLWAKPLLDNNEIKELVDPNIGDNYDRKEMDHMVLTAALCIEQSSILRPRMSQVVVLLRGDDYVSKCAKESKRRFLQRTYSEELSDAQEYNSTKYLGDLNRHKQVAFSS

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-116 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XVPKSEGTFGYFAPEYFMHGIVDEKTDVYSFGVLLLELITGRPALDDLQKSLVLWAKPLLDNNEIKELVDPNIGDNYDRKEMDHMVLTAALCIEQSSILRPRMSQVVVLLRGDDYV

HMMPanther: PTHR24420:SF794
2-154 SUBFAMILY NOT NAMED

VPKSEGTFGYFAPEYFMHGIVDEKTDVYSFGVLLLELITGRPALDDLQKSLVLWAKPLLDNNEIKELVDPNIGDNYDRKEMDHMVLTAALCIEQSSILRPRMSQVVVLLRGDDYVSKCAKESKRRFLQRTYSEELSDAQEYNSTKYLGDLNRH

HMMPanther: PTHR24420
2-154 FAMILY NOT NAMED,FAMILY NOT NAMED

VPKSEGTFGYFAPEYFMHGIVDEKTDVYSFGVLLLELITGRPALDDLQKSLVLWAKPLLDNNEIKELVDPNIGDNYDRKEMDHMVLTAALCIEQSSILRPRMSQVVVLLRGDDYVSKCAKESKRRFLQRTYSEELSDAQEYNSTKYLGDLNRH

Gene3D: G3DSA:1.10.510.10
6-107 no description

EGTFGYFAPEYFMHGIVDEKTDVYSFGVLLLELITGRPALDDLQKSLVLWAKPLLDNNEIKELVDPNIGDNYDRKEMDHMVLTAALCIEQSSILRPRMSQVV

superfamily: SSF56112
IPR011009
7-141 Protein kinase-like (PK-like)
Protein kinase-like domain

GTFGYFAPEYFMHGIVDEKTDVYSFGVLLLELITGRPALDDLQKSLVLWAKPLLDNNEIKELVDPNIGDNYDRKEMDHMVLTAALCIEQSSILRPRMSQVVVLLRGDDYVSKCAKESKRRFLQRTYSEELSDAQE

HMMPfam: PF07714
IPR001245
9-108 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

FGYFAPEYFMHGIVDEKTDVYSFGVLLLELITGRPALDDLQKSLVLWAKPLLDNNEIKELVDPNIGDNYDRKEMDHMVLTAALCIEQSSILRPRMSQVVV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox