PRGDB00071028 (Mdo.24962)

From PRG Wiki
Jump to: navigation, search
Mdo.24962
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 91046351 (EB156769)
Gene Class Unknown
Domain Type LRR
Gene Species Malus x domestica

Comment?

030221ABLC006578HT (ABLC) Braeburn cell culture three days after subculture Malus x domestica cDNA clone ABLC006578, mRNA sequence

DNA Sequence

CAATAACGAACTGGGAGGACATATCCCGTATGAACTCTATCAACTAAACAACTTAGCCGAGTTATTTTTGGGTGGTAATCGGCTTTTTGGTTCTATTCCTTCCTGCTTGGGTACTTTGGCAGTACCTCTAAGAAAATTATCGTTACGGTCCAATTTGTTAAATTCAAAAATACCATCTTCCTTGTGGGAACTCAATTATTTATTGTACCTAAACTTGTCATCCAATTCTCTAGTTGGACCACTCTCAGAAGACATAGGACAGTTGAAAGATGTGGTGGATATGGATTTATCAAATAACCATTTCTCCGGAAACTTTCCCGGTAGCATTGGGGGTCTTGAGAATATGATTGATTTCTCCTTGGCAAACAATTATTTAGAAGGCCTTATTCCCAATTCATTTAAAAAATTGCTAAGCCTAGAATTCTTGGATTTGTCCAAAAACAATCTATCTGGAGAGATCCCAAAGTCATTGGAAGCACTTCTGTATCTCAAGCATCTGAATTTGTCTTTCAACAAACTCCACGGTGAAATTCCAATCGGCGGGCCTTTCGGAAACTTCTCTGCTGATTCATTTGTATCAAACGGTGCGCTCTGCGGTGCTTCCCGATTCCATGTTCCCCTGTGCAAAAATATAACAAAAGTTAAGCCAAATTGGAGGAAAGCTAAATACATCATCTCANGGGTCATATCAGTAATACTCCTAGCAGTCGCTGCATTGATTCTGATACTAT


Protein sequences

Name Description Sequence
Mdo.24962 translated coding region predicted by ESTScan from UniGene Mdo.24962

XNNELGGHIPYELYQLNNLAELFLGGNRLFGSIPSCLGTLAVPLRKLSLRSNLLNSKIPSSLWELNYLLYLNLSSNSLVGPLSEDIGQLKDVVDMDLSNNHFSGNFPGSIGGLENMIDFSLANNYLEGLIPNSFKKLLSLEFLDLSKNNLSGEIPKSLEALLYLKHLNLSFNKLHGEIPIGGPFGNFSADSFVSNGALCGASRFHVPLCKNITKVKPNWRKAKYIISXVISVILLAVAALILILX


Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.80.10.10
2-199 no description

NNELGGHIPYELYQLNNLAELFLGGNRLFGSIPSCLGTLAVPLRKLSLRSNLLNSKIPSSLWELNYLLYLNLSSNSLVGPLSEDIGQLKDVVDMDLSNNHFSGNFPGSIGGLENMIDFSLANNYLEGLIPNSFKKLLSLEFLDLSKNNLSGEIPKSLEALLYLKHLNLSFNKLHGEIPIGGPFGNFSADSFVSNGALC

HMMPanther: PTHR24420:SF474
2-244 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

NNELGGHIPYELYQLNNLAELFLGGNRLFGSIPSCLGTLAVPLRKLSLRSNLLNSKIPSSLWELNYLLYLNLSSNSLVGPLSEDIGQLKDVVDMDLSNNHFSGNFPGSIGGLENMIDFSLANNYLEGLIPNSFKKLLSLEFLDLSKNNLSGEIPKSLEALLYLKHLNLSFNKLHGEIPIGGPFGNFSADSFVSNGALCGASRFHVPLCKNITKVKPNWRKAKYIISXVISVILLAVAALILIL

HMMPanther: PTHR24420
2-244 FAMILY NOT NAMED,FAMILY NOT NAMED

NNELGGHIPYELYQLNNLAELFLGGNRLFGSIPSCLGTLAVPLRKLSLRSNLLNSKIPSSLWELNYLLYLNLSSNSLVGPLSEDIGQLKDVVDMDLSNNHFSGNFPGSIGGLENMIDFSLANNYLEGLIPNSFKKLLSLEFLDLSKNNLSGEIPKSLEALLYLKHLNLSFNKLHGEIPIGGPFGNFSADSFVSNGALCGASRFHVPLCKNITKVKPNWRKAKYIISXVISVILLAVAALILIL

superfamily: SSF52058
2-207 L domain-like,LRR

NNELGGHIPYELYQLNNLAELFLGGNRLFGSIPSCLGTLAVPLRKLSLRSNLLNSKIPSSLWELNYLLYLNLSSNSLVGPLSEDIGQLKDVVDMDLSNNHFSGNFPGSIGGLENMIDFSLANNYLEGLIPNSFKKLLSLEFLDLSKNNLSGEIPKSLEALLYLKHLNLSFNKLHGEIPIGGPFGNFSADSFVSNGALCGASRFHVP

Seg: seg
44-57 seg

LRKLSLRSNLLNSK

Seg: seg
60-78 seg

SSLWELNYLLYLNLSSNSL

HMMPfam: PF13855
95-150 LRR_8,Leucine rich repeat

MDLSNNHFSGNFPGSIGGLENMIDFSLANNYLEGLIPNSFKKLLSLEFLDLSKNNL

FPrintScan: PR00019
140-153 LEURICHRPT,Leucine-rich repeat signature

LEFLDLSKNNLSGE

FPrintScan: PR00019
161-174 LEURICHRPT,Leucine-rich repeat signature

LLYLKHLNLSFNKL

HMMPfam: PF00560
IPR001611
164-181 LRR_1
Leucine-rich repeat

LKHLNLSFNKLHGEIPIG

Seg: seg
225-244 seg

IISXVISVILLAVAALILIL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox