PRGDB00071029 (Mdo.24965)

From PRG Wiki
Jump to: navigation, search
Mdo.24965
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 226814066 (GO568352)
Gene Class Unknown
Domain Type
Gene Species Malus x domestica

Comment?

NP_199390.1| leucine-rich repeat transmembrane protein kinase, putative [Arabidopsis thaliana] dbj|BAB09221.1| receptor-like protein kinase [Arabidopsis thaliana], mRNA sequence

DNA Sequence

GCTCCGAttttttttttttttttttGATTCTAGTACCGATGTTTTAATAAACGCAGAAAATTAAGATTAATTCCAGTTCTCATTTGTAAGTAATCATGTTAGTTTGATTAGGAAAGAACTCTAAGGGAAATTAGCAACTCTATCCCAACAACAAAATGTAAGATTCATTTACAGTTGCACTTTCCTTTTGAACTTAGCTGCGAGAGGGTGGAATGACGGCCCTGGCGACCTGACCTAATCCACGTCTGCATTTACAGTTGCACTTTAAATCTACAACTCGATATTTTCTTGTCACCGAGGTCCTGAAAGTTCCATGGCTTCAATGATGAAAGACGACTCTTGACGCACATCACTACAAGTCCTGGAGAAATCATGAGCCCTGGCCTCAAAGAGGTTGGTTCCGCCTTGTGATACCTCTGTATGTCCTGAATGCCCAACAAGGCCTTCCAAAATCTTCAAGACGTCTGACATCTTTGGTCGGAGGATGGGGCTTGATTGAGTGCACTGAAGAGCTAACTCGACACATTGTTCCAGTTCGATTGCATCGAAACATCCTTTAAGATCTCGGTCTACTAACACTTCAAGCCTTTTCTCCTCATGTAGGGTTCTAACCAAATCAAGAATCATTCCCTTCTGAACTTGACCATTTC


Protein sequences

Name Description Sequence
Mdo.24965 translated coding region predicted by ESTScan from UniGene Mdo.24965

XNGQVQKGMILDLVRTLHEEKRLEVLVDRDLKGCFDAIELEQCVELALQCTQSSPILRPKMSDVLKILEGLVGHSGHTEVSQGGTNLFEARAHDFSRTCSDVRQESSFIIEAMELSGPR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF737
2-115 SUBFAMILY NOT NAMED

NGQVQKGMILDLVRTLHEEKRLEVLVDRDLKGCFDAIELEQCVELALQCTQSSPILRPKMSDVLKILEGLVGHSGHTEVSQGGTNLFEARAHDFSRTCSDVRQESSFIIEAMEL

HMMPanther: PTHR24420
2-115 FAMILY NOT NAMED,FAMILY NOT NAMED

NGQVQKGMILDLVRTLHEEKRLEVLVDRDLKGCFDAIELEQCVELALQCTQSSPILRPKMSDVLKILEGLVGHSGHTEVSQGGTNLFEARAHDFSRTCSDVRQESSFIIEAMEL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox