PRGDB00071030 (Mdo.24983)

From PRG Wiki
Jump to: navigation, search
Mdo.24983
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 71826044 (DT003436)
Gene Class Unknown
Domain Type LRR
Gene Species Malus x domestica

Comment?

BAB11221.1| disease resistance protein [Arabidopsis thaliana], mRNA sequence

DNA Sequence

CGAATTCCGTTGCTGTCGGGTTCATTTTATATAAATTCCTGCACATCTCTTTCCGAGTTTTATGAGCTTCCCAGGGATATAAATGAATTATCATTGGTTAGTTGCACGAGACTTGTGAGTCTACCAACCAACATTTGTAAGTTGAAATATCTCAAGGGACTCAATCTTTCCGGATGCTTTAAACTTGAAAACTTCCCAGAGATCTTGGAGCCAATGGAACATTTGAAGTCCTTAAATTTAAGTGGAACAGCGGTTCAAGAGCTACACTCATTAATCGAGTTTCTCCCTGCTCTCAAAAGACTTATACTAAAACGTTGCAAAAGGCTTTCAAGTATGCCAAAGAGCATTTGTAAGTTGAAATATCTCGAGGTACTCAATCTCTCCAGCTGCTGTAAATTTGAAGACTTACCAGAGATCTTGGAGCCAATGGAACATTTGAAGTTTTTAAATTTTAGAAAAACAGCGGTTCAAGAGCTACACTCATTAATTGAGTTTCTCCCTGCTCTCAAAATACTTAACCTACAACGTTGCAAAAGGCTTTCAAGTATCCCAAAGAGCATTTGTAAGTTGAAATATCTTGAGGAACTCAACCTCTCTTGGTGCTCCAAACTTGAAAACTTCCCAGAGATTTTGGAGCCAATGGAACATTTGAAGTCTTTAAATTTAAGTGGAACAGCGGTTCAAGTGCTACACTCATCAGTCGAGTTTCTCCCTGCTCTG


Protein sequences

Name Description Sequence
Mdo.24983 translated coding region predicted by ESTScan from UniGene Mdo.24983

RIPLLSGSFYINSCTSLSEFYELPRDINELSLVSCTRLVSLPTNICKLKYLKGLNLSGCFKLENFPEILEPMEHLKSLNLSGTAVQELHSLIEFLPALKRLILKRCKRLSSMPKSICKLKYLEVLNLSSCCKFEDLPEILEPMEHLKFLNFRKTAVQELHSLIEFLPALKILNLQRCKRLSSIPKSICKLKYLEELNLSWCSKLENFPEILEPMEHLKSLNLSGTAVQVLHSSVEFLPAL


Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.80.10.10
22-119 no description

ELPRDINELSLVSCTRLVSLPTNICKLKYLKGLNLSGCFKLENFPEILEPMEHLKSLNLSGTAVQELHSLIEFLPALKRLILKRCKRLSSMPKSICKL

HMMPanther: PTHR23155
22-240 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

ELPRDINELSLVSCTRLVSLPTNICKLKYLKGLNLSGCFKLENFPEILEPMEHLKSLNLSGTAVQELHSLIEFLPALKRLILKRCKRLSSMPKSICKLKYLEVLNLSSCCKFEDLPEILEPMEHLKFLNFRKTAVQELHSLIEFLPALKILNLQRCKRLSSIPKSICKLKYLEELNLSWCSKLENFPEILEPMEHLKSLNLSGTAVQVLHSSVEFLPAL

superfamily: SSF52047
24-240 RNI-like,LRR

PRDINELSLVSCTRLVSLPTNICKLKYLKGLNLSGCFKLENFPEILEPMEHLKSLNLSGTAVQELHSLIEFLPALKRLILKRCKRLSSMPKSICKLKYLEVLNLSSCCKFEDLPEILEPMEHLKFLNFRKTAVQELHSLIEFLPALKILNLQRCKRLSSIPKSICKLKYLEELNLSWCSKLENFPEILEPMEHLKSLNLSGTAVQVLHSSVEFLPAL

HMMPfam: PF00560
IPR001611
51-67 LRR_1
Leucine-rich repeat

LKGLNLSGCFKLENFPE

HMMPfam: PF13855
96-153 LRR_8,Leucine rich repeat

PALKRLILKRCKRLSSMPKSICKLKYLEVLNLSSCCKFEDLPEILEPMEHLKFLNFRK

Seg: seg
98-109 seg

LKRLILKRCKRL

Gene3D: G3DSA:3.80.10.10
120-189 no description

KYLEVLNLSSCCKFEDLPEILEPMEHLKFLNFRKTAVQELHSLIEFLPALKILNLQRCKRLSSIPKSICK

HMMPfam: PF13855
167-225 LRR_8,Leucine rich repeat

PALKILNLQRCKRLSSIPKSICKLKYLEELNLSWCSKLENFPEILEPMEHLKSLNLSGT

Gene3D: G3DSA:3.80.10.10
190-240 no description

LKYLEELNLSWCSKLENFPEILEPMEHLKSLNLSGTAVQVLHSSVEFLPAL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox