PRGDB00071031 (Mdo.25058)

From PRG Wiki
Jump to: navigation, search
Mdo.25058
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 226758117 (GO513069)
Gene Class Unknown
Domain Type
Gene Species Malus x domestica

Comment?

AAG34696.1| NEC1 [Petunia x hybrida], mRNA sequence

DNA Sequence

ATCGAATTCCGTTGCTGTCGGTATACGCATCCAAGAATGACAAGATTACTACATTGATTTGGATCCTACTAGTAAATGTAGCCGCTTTAGGGTTGGTGCTGGCAGTCACCTTCTTCCTTCTTGGAGGGACAGTGCGCATAAGCGCCGTTGGATGGATTTGTGCCGTGTTTAACATTGCTGTATTTGCTGCTCCTCTAAGCATTATGAGGCAAGTAATAAGAACCAAAAGTGTGGAATTCATGCCATTTTCTTTGTCCTTTTTCCTGACACTTTGTGCCACCATGTGGTTCTTCTACGGATTTTTTACAAAAGATTACTACATTGCATTACCAAACGTATTAGGGTTTCTCTTTGGCATTGCCCAAATGACCCTATACATGACATACAAGACTTCAGGAAACAATGTCGAAGAGAAAAAGAGTACTCAGGAGATGAAGAAGTTGAGCTCGACCAATCGTCCAAAGTTGGTGCGCAGCGTGAGTGAATATCCAAGATCAGATAAACTAAATCAGATTACGTATGTCTACGAAGCAAACGATGAACACGTATAGTACCCACAGTTTAAGCTCAAGATTGAAGATTTGATATAAATCGAGCCTTAATTTTCTGTTCACCCATAGTGTATAATTCATATATGAACAGTAGATGGTAATAACTCTAGGAATAAAGCCTTGCTGTGTACATGCAAT


Protein sequences

Name Description Sequence
Mdo.25058 translated coding region predicted by ESTScan from UniGene Mdo.25058

XRIPLLSVYASKNDKITTLIWILLVNVAALGLVLAVTFFLLGGTVRISAVGWICAVFNIAVFAAPLSIMRQVIRTKSVEFMPFSLSFFLTLCATMWFFYGFFTKDYYIALPNVLGFLFGIAQMTLYMTYKTSGNNVEEKKSTQEMKKLSSTNRPKLVRSVSEYPRSDKLNQITYVYEANDEHV


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10791
IPR004316
22-157 RAG1-ACTIVATING PROTEIN 1
RAG1-activating protein-1-related

ILLVNVAALGLVLAVTFFLLGGTVRISAVGWICAVFNIAVFAAPLSIMRQVIRTKSVEFMPFSLSFFLTLCATMWFFYGFFTKDYYIALPNVLGFLFGIAQMTLYMTYKTSGNNVEEKKSTQEMKKLSSTNRPKLV

Seg: seg
23-43 seg

LLVNVAALGLVLAVTFFLLGG

HMMPfam: PF03083
IPR004316
49-132 MtN3_slv
RAG1-activating protein-1-related

AVGWICAVFNIAVFAAPLSIMRQVIRTKSVEFMPFSLSFFLTLCATMWFFYGFFTKDYYIALPNVLGFLFGIAQMTLYMTYKTS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox