PRGDB00071034 (Mdo.25117)

From PRG Wiki
Jump to: navigation, search
Mdo.25117
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 226794013 (GO549388)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Malus x domestica

Comment?

NP_200638.1| leucine-rich repeat transmembrane protein kinase, putative [Arabidopsis thaliana] dbj|BAA96921.1| receptor-like protein kinase [Arabidopsis thaliana] gb|AAL576>

DNA Sequence

GCTCGCAttttttttttttttttttccaaatttccaattgcattccaaaaacaagatgacaatgcttaaacagaaaaagaaaagaaaataaaataaaataaaGAGTACTGGATTTTTTTCATGGGGTTTGCACATTAAATTCCGACTCGGAGGATTGCCTAGTTTTGGTGTCGGATTGCCGGAGTTCCTCTATCATTCTGACTACTTCATCCATGTTGGGGCGTGTTTCGGGCAATTTTGTTACGCATGCCAAAGCAATCTGCAGCATCTGCACCATCTCTTCTTCACTGTGTTGCTGTTTTAGAAGTTCCAAATCAAAAACCTCAGCTGTCCACTCCTCACGCACAACAGACTTAACCCAACGCGGGAGATCAACCACGCAGTCATAACCTGGATATTGAAGCGTGGTTTTGCCTGTCAGCATTTCTAAGAGGACCACACCAAAGCTATAGACATCAGATTTGTGAGTGATTTTCCGCATGTCAGTTGCCTCGGGAGCGCGATATCCCATGGCCCGGGACATGGCTGAGAGGGAAGTTCATTAGAGGACTCAACCCTACGTCTGAGATGCAAGCCTCGAGTTCTTGGGTGAGTAGGACGTTTGTGGACTTTATATTGC


Protein sequences

Name Description Sequence
Mdo.25117 translated coding region predicted by ESTScan from UniGene Mdo.25117

XQYKVHKRPTHPRTRGLHLRRRVESSNELPSQPCPGPWDIAAPEATDMRKITHKSDVYSFGVVLLEMLTGKTTLQYPGYDCVVDLPRWVKSVVREEWTAEVFDLELLKQQHSEEEMVQMLQIALACVTKLPETRPNMDEVVRMIEELRQSDTKTRQSSESEFNVQTP

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-147 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XQYKVHKRPTHPRTRGLHLRRRVESSNELPSQPCPGPWDIAAPEATDMRKITHKSDVYSFGVVLLEMLTGKTTLQYPGYDCVVDLPRWVKSVVREEWTAEVFDLELLKQQHSEEEMVQMLQIALACVTKLPETRPNMDEVVRMIEEL

HMMPfam: PF07714
IPR001245
25-143 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

SSNELPSQPCPGPWDIAAPEATDMRKITHKSDVYSFGVVLLEMLTGKTTLQYPGYDCVVDLPRWVKSVVREEWTAEVFDLELLKQQHSEEEMVQMLQIALACVTKLPETRPNMDEVVRM

Gene3D: G3DSA:1.10.510.10
30-160 no description

PSQPCPGPWDIAAPEATDMRKITHKSDVYSFGVVLLEMLTGKTTLQYPGYDCVVDLPRWVKSVVREEWTAEVFDLELLKQQHSEEEMVQMLQIALACVTKLPETRPNMDEVVRMIEELRQSDTKTRQSSES

superfamily: SSF56112
IPR011009
42-152 Protein kinase-like (PK-like)
Protein kinase-like domain

APEATDMRKITHKSDVYSFGVVLLEMLTGKTTLQYPGYDCVVDLPRWVKSVVREEWTAEVFDLELLKQQHSEEEMVQMLQIALACVTKLPETRPNMDEVVRMIEELRQSDT

HMMPanther: PTHR24420:SF547
42-149 SUBFAMILY NOT NAMED

APEATDMRKITHKSDVYSFGVVLLEMLTGKTTLQYPGYDCVVDLPRWVKSVVREEWTAEVFDLELLKQQHSEEEMVQMLQIALACVTKLPETRPNMDEVVRMIEELRQ

HMMPanther: PTHR24420
42-149 FAMILY NOT NAMED,FAMILY NOT NAMED

APEATDMRKITHKSDVYSFGVVLLEMLTGKTTLQYPGYDCVVDLPRWVKSVVREEWTAEVFDLELLKQQHSEEEMVQMLQIALACVTKLPETRPNMDEVVRMIEELRQ






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox