PRGDB00071068 (Mdo.26856)

From PRG Wiki
Jump to: navigation, search
Mdo.26856
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 71815168 (DR992559)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Malus x domestica

Comment?

NP_190342.1| leucine-rich repeat transmembrane protein kinase, putative [Arabidopsis thaliana] >pir|T45718 receptor-kinase like protein - Arabidopsis thaliana >emb|CAB61984.1| receptor->

DNA Sequence

CACGAGGAAATGCGAGTGCTATTTCAGTTGTTGGCAACACTAATCTGTGCAGCCCTGTTGCTAATTTAAAGCTTCCCAAGTGCAAATCTAAAGAGACCAAGAAACGAAGATTGTCTCATCGCTTGAAACTAATTCTCCCTTTAGTATTTGGACTTACTCTTCTAGGAATAGCCATGGTGTTCTCCTATTTCTTTCTTTGTTCGTCAAGGAAGAAAAGGAAAGAAATTTCATTGAGCACTTTGGGGAACACTATTATGCAAGTGTCATATGCTACTCTACTCAAAGCTACTGATGGGTTCTCAAAGGCTAATTTAATTGGTGCTGGTAGTTTTGGGTCTGTGTACAAAGGAGTTCTTGATGAGGATGATAAAGCTTAACTTGTTGCCGTGAAGGTGTTTAACTTGTTACGCCGTGGAGCTTCAAAAAGTTTCATAGCCGAATGTGAAGCTTTGAGAAATATTAGGCACCGAAATCTTGTCAAGATTATAACCGTGTGTTCAAGTGTTGATTTTCATGGTAATGATTTCAAGGCTCTAGTTTATGAGTACATGGACAACGGGAGCTTAGAGGA


Protein sequences

Name Description Sequence
Mdo.26856 translated coding region predicted by ESTScan from UniGene Mdo.26856

XRGNASAISVVGNTNLCSPVANLKLPKCKSKETKKRRLSHRLKLILPLVFGLTLLGIAMVFSYFFLCSSRKKRKEISLSTLGNTIMQVSYATLLKATDGFSKANLIGAGSFGSVYKGVLDEDDKAXLVAVKVFNLLRRGASKSFIAECEALRNIRHRNLVKIITVCSSVDFHGNDFKALVYEYMDNGSLEX

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF474
4-190 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

NASAISVVGNTNLCSPVANLKLPKCKSKETKKRRLSHRLKLILPLVFGLTLLGIAMVFSYFFLCSSRKKRKEISLSTLGNTIMQVSYATLLKATDGFSKANLIGAGSFGSVYKGVLDEDDKAXLVAVKVFNLLRRGASKSFIAECEALRNIRHRNLVKIITVCSSVDFHGNDFKALVYEYMDNGSLE

HMMPanther: PTHR24420
4-190 FAMILY NOT NAMED,FAMILY NOT NAMED

NASAISVVGNTNLCSPVANLKLPKCKSKETKKRRLSHRLKLILPLVFGLTLLGIAMVFSYFFLCSSRKKRKEISLSTLGNTIMQVSYATLLKATDGFSKANLIGAGSFGSVYKGVLDEDDKAXLVAVKVFNLLRRGASKSFIAECEALRNIRHRNLVKIITVCSSVDFHGNDFKALVYEYMDNGSLE

Gene3D: G3DSA:2.60.120.200
IPR013320
22-118 no description
Concanavalin A-like lectin/glucanase, subgroup

NLKLPKCKSKETKKRRLSHRLKLILPLVFGLTLLGIAMVFSYFFLCSSRKKRKEISLSTLGNTIMQVSYATLLKATDGFSKANLIGAGSFGSVYKGV

superfamily: SSF56112
IPR011009
89-189 Protein kinase-like (PK-like)
Protein kinase-like domain

SYATLLKATDGFSKANLIGAGSFGSVYKGVLDEDDKAXLVAVKVFNLLRRGASKSFIAECEALRNIRHRNLVKIITVCSSVDFHGNDFKALVYEYMDNGSL

ProfileScan: PS50011
IPR000719
100-191 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSKANLIGAGSFGSVYKGVLDEDDKAXLVAVKVFNLLRRGASKSFIAECEALRNIRHRNLVKIITVCSSVDFHGNDFKALVYEYMDNGSLEX

HMMPfam: PF07714
IPR001245
103-190 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

ANLIGAGSFGSVYKGVLDEDDKAXLVAVKVFNLLRRGASKSFIAECEALRNIRHRNLVKIITVCSSVDFHGNDFKALVYEYMDNGSLE

PatternScan: PS00107
IPR017441
106-131 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGAGSFGSVYKGVLDEDDKAXLVAVK

Gene3D: G3DSA:3.30.200.20
119-185 no description

LDEDDKAXLVAVKVFNLLRRGASKSFIAECEALRNIRHRNLVKIITVCSSVDFHGNDFKALVYEYMD






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox