PRGDB00071103 (Mdo.29133)

From PRG Wiki
Jump to: navigation, search
Mdo.29133
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 226798589 (GO552735)
Gene Class Mlo-like
Domain Type MLO
Gene Species Malus x domestica

Comment?

NP_192169.1| seven transmembrane MLO protein family (MLO1) [Arabidopsis thaliana] sp|O49621|MLO1_ARATH MLO-like protein 1 (AtMlo1) (MLO protein homolog 1) (AtMLO-H1) pir|T01089 hypothe>

DNA Sequence

GCTCGCAttttttttttttttttttGGAAAAACTGGATACATAATTCATAATACCTTGATTCCTGAATATAATTTCTACATTCCGAATCGGAAATATTTCATAAAAATTCGTAGTAAATTATGATTTGACATTTGAGTTCCTCAGGCCCCCCTATGCAGAATAATAATCTAGAGGGTGGTGAGAGCTACGGCTATATTTGACTCTACAAAAAGATATATATCATGTGAAGAAGAGATGTTCAGCCCTTGGTCGTTGTCTTTTGGTTAACTTTGCCTAGCTGAACTCCCACGGAGGAACCAGAGGTAGATCCAGATCCGTCGACGCTGCTCGCCTTCCTTTTCTTTGCCTTCTGAGCCCAACCAATAAGTCCCGAGCGTATACCCTCGTCGAATATTGCTTTCTTGAATTTGGTTCCCATCTGCGTGACAATGGCATAAAGTGGTAGAGTACTGTAACTACAGAGCACCTGAATGAACACCCCAATAACAAGCCTGGGGACAATGTATCTTACTTTTCCCATTATGCAAGATGTAAAACCATATTGAACCCATATCCAGAAAAAGAATGCCATTTCGAAAGCATTTTGGAAGAGGATGAGATGAATCAAGAAGAGAACAAATTTGGGCTTGCCAAACCAAAAGTGCTTGTCTGATGGTTGAACTATTAGTTCTCCTTC


Protein sequences

Name Description Sequence
Mdo.29133 translated coding region predicted by ESTScan from UniGene Mdo.29133

EGELIVQPSDKHFWFGKPKFVLFLIHLILFQNAFEMAFFFWIWVQYGFTSCIMGKVRYIVPRLVIGVFIQVLCSYSTLPLYAIVTQMGTKFKKAIFDEGIRSGLIGWAQKAKKRKASSVDGSGSTSGSSVGVQLGKVNQKTTTKG

Domains

Domain Start-End Description Sequence

HMMPfam: PF03094
IPR004326
2-124 Mlo
Mlo-related protein

GELIVQPSDKHFWFGKPKFVLFLIHLILFQNAFEMAFFFWIWVQYGFTSCIMGKVRYIVPRLVIGVFIQVLCSYSTLPLYAIVTQMGTKFKKAIFDEGIRSGLIGWAQKAKKRKASSVDGSGS

Seg: seg
117-132 seg

SSVDGSGSTSGSSVGV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox