PRGDB00071107 (Mdo.29998)

From PRG Wiki
Jump to: navigation, search
Mdo.29998
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 226811525 (GO566648)
Gene Class Unknown
Domain Type
Gene Species Malus x domestica

Comment?

BAC20033.1| putative NADPH HC toxin reductase [Oryza sativa (japonica cultivar-group)], mRNA sequence

DNA Sequence

GCCAGCAttttttttttttttttttgttttttAAATTTACACTAAACTGAATGAATTTGTCTTAACACATACAATTCTGAAATAGTTATGCTAATGAGTATACAAGATTTTGTTTATTCAATAAGTGAGGATCTCTCACAATACTAGAATATGCAGAGCCTAACAACGAAAACACGATTACACCAGCGTTTGTAATATGATGTTTTTGTTTCTGCAGTCTGAAAATTAAATCAGTTGAGAAAGAGAGCTCTCTGATAACCTCCTTCCACTTGCTACACTGTCATCAAGTATGTTCTTCACGCCATACTTGTACTCAAAACCGATCTTCACCAGCTTAGTAAAGTCACATTTGATTCCTTCTTCTGGTCCTTCGGCGAATTCTTTTGCTATCTTGTATTCCGGGTAGTTTTCTTGGAAGCAGGCAGCGATTTCTTTGATACTAGGACTGGCAACTGCACAGCAGAATCTGCCTCTCATCGATGGTTGTTCCATGCAGAAGATATGTCCTCGGCAAACATCTTCAATGTGTACAAGAGGAACAGAACCGATAACTTCTTGCATGAATTTTAATGCATTGTAACCATTCAAGTCCCCGGTAAGTTGTGATATAACTACTCCCACACTTA


Protein sequences

Name Description Sequence
Mdo.29998 translated coding region predicted by ESTScan from UniGene Mdo.29998

XSVGVVISQLTGDLNGYNALKFMQEVIGSVPLVHIEDVCRGHIFCMEQPSMRGRFCCAVASPSIKEIAACFQENYPEYKIAKEFAEGPEEGIKCDFTKLVKIGFEYKYGVKNILDDSVASGRRLSESSLSQLI

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10366:SF81
5-126 OS07G0601100 PROTEIN,OS07G0601100 PROTEIN

VVISQLTGDLNGYNALKFMQEVIGSVPLVHIEDVCRGHIFCMEQPSMRGRFCCAVASPSIKEIAACFQENYPEYKIAKEFAEGPEEGIKCDFTKLVKIGFEYKYGVKNILDDSVASGRRLSE

HMMPanther: PTHR10366
5-126 FAMILY NOT NAMED,NAD DEPENDENT EPIMERASE/DEHYDRATASE

VVISQLTGDLNGYNALKFMQEVIGSVPLVHIEDVCRGHIFCMEQPSMRGRFCCAVASPSIKEIAACFQENYPEYKIAKEFAEGPEEGIKCDFTKLVKIGFEYKYGVKNILDDSVASGRRLSE

superfamily: SSF51735
31-124 NAD(P)-binding Rossmann-fold domains

PLVHIEDVCRGHIFCMEQPSMRGRFCCAVASPSIKEIAACFQENYPEYKIAKEFAEGPEEGIKCDFTKLVKIGFEYKYGVKNILDDSVASGRRL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox