PRGDB00071108 (Mdo.30095)

From PRG Wiki
Jump to: navigation, search
Mdo.30095
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 226814051 (GO567751)
Gene Class Unknown
Domain Type LRR
Gene Species Malus x domestica

Comment?

AAD50430.1|AF166121_1 Cf2

DNA Sequence

TCGAGtttttttttttttttttttACTAGTCAATAAGTTTTTTATTTCTCAAAGAAAAGTACACTTGATTAACGCACAAAGCGATCTACAACATTGGAGAAAAATTCGAAATATGCATATCGCCATGACCTGCTCAAAGCTAAAGGGCCACAAACTCCCCAAAACCCTACAATGAAACCAAGAGACACTGAAATTTGAAGCCATGGAATTCCATTCCCAGAGTCATGTACATCTTCCTGGTCCTTAGTCGTATCACTATCTCCTGGGCTCTTCTTTTGGCACTCATTTGGAAGCGGGGAGCCGCAAAGTCCTGGGTTACCCTCAAAGGCAGTAGCATCGAAGCTTTGGAGCTGAGTGCCTAATGGTATTTGGCCTTGGAGGTTATTGTAGGCAACACTAAATGAAGACAAGAAATTAAGACCTGATAGTGATGCTGGGATTTCACCCGAAAGATTGTTTCTTGAGAGGTCTAATTTATCCAAGTTTCGGAGGTTCGAGATTTGGTGTGGAATGTTGCCAGACAATTTGTTCAAACTAATATCCAGTTGTTGGAGAAGTTGCAATTGCCCAATATCGCGGGGTATATTGCCACTTAGACTGTTGTTCCCGAGGTTGATTGCTGTCCTTAAGTTGGACAAATACTTGACCTGTAACAAAACTGCAGACCCATT


Protein sequences

Name Description Sequence
Mdo.30095 translated coding region predicted by ESTScan from UniGene Mdo.30095

NGSAVLLQVKYLSNLRTAINLGNNSLSGNIPRDIGQLQLLQQLDISLNKLSGNIPHQISNLRNLDKLDLSRNNLSGEIPASLSGLNFLSSFSVAYNNLQGQIPLGTQLQSFDATAFEGNPGLCGSPLPNECQKKSPGDSDTTKDQEDVHDSGNGIPWLQISVSLGFIVGFWGVCGPLALSRSWRYAYFEFFSNVVDRFVR


Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.80.10.10
18-127 no description

AINLGNNSLSGNIPRDIGQLQLLQQLDISLNKLSGNIPHQISNLRNLDKLDLSRNNLSGEIPASLSGLNFLSSFSVAYNNLQGQIPLGTQLQSFDATAFEGNPGLCGSPL

HMMPanther: PTHR24420:SF478
19-124 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

INLGNNSLSGNIPRDIGQLQLLQQLDISLNKLSGNIPHQISNLRNLDKLDLSRNNLSGEIPASLSGLNFLSSFSVAYNNLQGQIPLGTQLQSFDATAFEGNPGLCG

HMMPanther: PTHR24420
19-124 FAMILY NOT NAMED,FAMILY NOT NAMED

INLGNNSLSGNIPRDIGQLQLLQQLDISLNKLSGNIPHQISNLRNLDKLDLSRNNLSGEIPASLSGLNFLSSFSVAYNNLQGQIPLGTQLQSFDATAFEGNPGLCG

superfamily: SSF52058
19-131 L domain-like,LRR

INLGNNSLSGNIPRDIGQLQLLQQLDISLNKLSGNIPHQISNLRNLDKLDLSRNNLSGEIPASLSGLNFLSSFSVAYNNLQGQIPLGTQLQSFDATAFEGNPGLCGSPLPNEC

Seg: seg
36-43 seg

QLQLLQQL

FPrintScan: PR00019
40-53 LEURICHRPT,Leucine-rich repeat signature

LQQLDISLNKLSGN

HMMPfam: PF00560
IPR001611
40-61 LRR_1
Leucine-rich repeat

LQQLDISLNKLSGNIPHQISNL

FPrintScan: PR00019
61-74 LEURICHRPT,Leucine-rich repeat signature

LRNLDKLDLSRNNL

HMMPfam: PF00560
IPR001611
63-85 LRR_1
Leucine-rich repeat

NLDKLDLSRNNLSGEIPASLSGL

Seg: seg
81-92 seg

SLSGLNFLSSFS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox