PRGDB00071109 (Mdo.30096)

From PRG Wiki
Jump to: navigation, search
Mdo.30096
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 226814059 (GO567754)
Gene Class Unknown
Domain Type LRR
Gene Species Malus x domestica

Comment?

AAP31049.1| putative receptor kinase [Hordeum vulgare], mRNA sequence

DNA Sequence

ttttttttttttttttttCTTGAAATCAATTTCATATTCATAATTTCATATCATGAATGCTAACAAGGTAGTCATCCGTAAGCCCCGAGCATGTACGAAACAAACTATAATAGCAAAGTTTAAAGGTTATTTAGCTACATATATTGGCGGCCTGGCCTACAACTAGATAGGCTTACAGGGAGTGAGAGGCTTTCCGCATAAGCCTGTGTTTCCGGAGTAAGAACTCTTGGGAAAGTCACTGAGCGGTTTGCCCTCTGGAATTTTCCCCACGAGATGATTGTTTGATAAATTCAATTCCTCCAGATTCCCCAGCTTCAGAAACTCGTCTGGAATTTTCCCCGAAAAGCGGTTTTGCTGCAACTCGAGCACCAGTAGCATGCTCAAGTTTCCCAAGGATTCTGGGATTGCTCCTTCAAGCTTGTTGTTCGATAGGTTAACCTCTCGGAGCGCAATCAAATCTCCAAAGTTTGTTGGTATGCTTCCGGTGAGACTATTATTCGCGAGCAATAAAAGCTTGAGAGATGGCATTTTTAAAACTGGAATTGGCCCCTCAAAAAAGTTATTGTGCAACCATATAGTTACAACGGATGATAAATTGGCCATTGAAGGGTGGAAGCTTCCCAGACAAACGGTTTCTTG


Protein sequences

Name Description Sequence
Mdo.30096 translated coding region predicted by ESTScan from UniGene Mdo.30096

QETVCLGSFHPSMANLSSVVTIWLHNNFFEGPIPVLKMPSLKLLLLANNSLTGSIPTNFGDLIALREVNLSNNKLEGAIPESLGNLSMLLVLELQQNRFSGKIPDEFLKLGNLEELNLSNNHLVGKIPEGKPLSDFPKSSYSGNTGLCGKPLTPCKPI


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
7-151 FAMILY NOT NAMED,FAMILY NOT NAMED

GSFHPSMANLSSVVTIWLHNNFFEGPIPVLKMPSLKLLLLANNSLTGSIPTNFGDLIALREVNLSNNKLEGAIPESLGNLSMLLVLELQQNRFSGKIPDEFLKLGNLEELNLSNNHLVGKIPEGKPLSDFPKSSYSGNTGLCGKP

Gene3D: G3DSA:3.80.10.10
9-154 no description

FHPSMANLSSVVTIWLHNNFFEGPIPVLKMPSLKLLLLANNSLTGSIPTNFGDLIALREVNLSNNKLEGAIPESLGNLSMLLVLELQQNRFSGKIPDEFLKLGNLEELNLSNNHLVGKIPEGKPLSDFPKSSYSGNTGLCGKPLTP

superfamily: SSF52058
11-156 L domain-like,LRR

PSMANLSSVVTIWLHNNFFEGPIPVLKMPSLKLLLLANNSLTGSIPTNFGDLIALREVNLSNNKLEGAIPESLGNLSMLLVLELQQNRFSGKIPDEFLKLGNLEELNLSNNHLVGKIPEGKPLSDFPKSSYSGNTGLCGKPLTPCK

Seg: seg
36-51 seg

LKMPSLKLLLLANNSL

HMMSmart: SM00369
IPR003591
38-61 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MPSLKLLLLANNSLTGSIPTNFGD

HMMPfam: PF00560
IPR001611
40-62 LRR_1
Leucine-rich repeat

SLKLLLLANNSLTGSIPTNFGDL

ProfileScan: PS51450
IPR001611
40-63 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLKLLLLANNSLTGSIPTNFGDLI

HMMSmart: SM00369
IPR003591
62-86 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LIALREVNLSNNKLEGAIPESLGNL

ProfileScan: PS51450
IPR001611
64-87 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ALREVNLSNNKLEGAIPESLGNLS

FPrintScan: PR00019
65-78 LEURICHRPT,Leucine-rich repeat signature

LREVNLSNNKLEGA

HMMPfam: PF13855
65-123 LRR_8,Leucine rich repeat

LREVNLSNNKLEGAIPESLGNLSMLLVLELQQNRFSGKIPDEFLKLGNLEELNLSNNHL

ProfileScan: PS51450
IPR001611
88-109 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

MLLVLELQQNRFSGKIPDEFLK

Seg: seg
106-123 seg

EFLKLGNLEELNLSNNHL

FPrintScan: PR00019
110-123 LEURICHRPT,Leucine-rich repeat signature

LGNLEELNLSNNHL

HMMSmart: SM00369
IPR003591
110-143 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LGNLEELNLSNNHLVGKIPEGKPLSDFPKSSYSG

ProfileScan: PS51450
IPR001611
112-134 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLEELNLSNNHLVGKIPEGKPLS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox