PRGDB00071110 (Mdo.30131)

From PRG Wiki
Jump to: navigation, search
Mdo.30131
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 226814560 (GO568112)
Gene Class Unknown
Domain Type
Gene Species Malus x domestica

Comment?

NP_173233.1| WAK-like kinase (WLK) [Arabidopsis thaliana] pir|C86314 hypothetical protein F2H15.13 - Arabidopsis thaliana gb|AAF97270.1|AC034106_13 Contains similarity to wall-associat>

DNA Sequence

GCACGCAttttttttttttttttttGATGCAAGATGACTTTTCAGATTGCTAGTAACAGTTTGGGCAGAAAACCTAAAACTGTCGGACACATCAAAATTATTAGCACATAAAACATCAAGAACAATCGGAGCATACAGACACCACTAAACAAGTTGATTAAAACCAGaaaaaaaaaaaaTACAAGACAAATTCTTGCTTCGAAAACAAGATCAGGGAAATCTCCAGTTTCCACCAATTGCTGGTCGTGATCAGTAAGATAGTAGTGGTAGTGAATCTTTTGACGGAGTAGTACCTCCAGCCAAACACGACCCTGTCGATGTAACATCCCAAGGACCAGTTACTTCATTTCTAACATATTCGACCTCATCGGAATTTTGTTGCAGATTATTAGAAGCGTTGACTGATTTTTGAATCCTCTCCAACTCCATTGCCACTTCTTTCATCGTAGGCCGTCTCTTTCCACTCATATCCAAGCATCTGTTTGCGAGGTTAGCAACTGACAATATGTCTTCTTTTACACCCTCCTCCTTAACTCGAGCATCAATAATATCAAACAGACGATTCTCTTCCATTGAAAAATTAAAATATGTAACTAGGCCTCTGAT


Protein sequences

Name Description Sequence
Mdo.30131 translated coding region predicted by ESTScan from UniGene Mdo.30131

IRGLVTYFNFSMEENRLFDIIDARVKEEGVKEDILSVANLANRCLDMSGKRRPTMKEVAMELERIQKSVNASNNLQQNSDEVEYVRNEVTGPWDVTSTGSCLAGGTTPSKDSLPLLSY

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF444
2-84 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

RGLVTYFNFSMEENRLFDIIDARVKEEGVKEDILSVANLANRCLDMSGKRRPTMKEVAMELERIQKSVNASNNLQQNSDEVEY

HMMPanther: PTHR24420
2-84 FAMILY NOT NAMED,FAMILY NOT NAMED

RGLVTYFNFSMEENRLFDIIDARVKEEGVKEDILSVANLANRCLDMSGKRRPTMKEVAMELERIQKSVNASNNLQQNSDEVEY






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox