PRGDB00071111 (Mgr.116)

From PRG Wiki
Jump to: navigation, search
Mgr.116
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 39976834 (XM_369805)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Magnaporthe grisea

Comment?

Magnaporthe grisea 70-15 hypothetical protein (MGG_06320) partial mRNA

DNA Sequence

ATGAACCCTGGACCTGCCCCCCGGCCGCCGACGGACAGACCGCGATTGAACCTCACGCCCAGTCAAAACCTACCTGGCAACATGGCCAACATGAGTTTGAACTCGCCCGGAATGGGTAGGGGCCAGTTCGGCGGCGGGTCGAGTGTCTACGGCGGGTCGACCATATCACTACCACTGAGTCGAGCTGCGTCCAACACAGACGGCCTGGGTGGGGTCGCCGTCATCAAGGAAGGTTGGGCGCAGGTTAAAGAAAGCAAAAACTTTATCAACCCGTGGAAGCAGAAGTATCTTATCCTGCGAAAGGAGGCCCTTGATTTCCACAAACAAGAGGGGAGCAAATCATCGTATACACTCTACCTCAAGGATGTGATCAATGTTGGTCGTGTAGAAGCAGCGGGCACCATTTTCGAGGTCAAGCGCCAGTCCAATGGCACATCAACGAGCCCCGGCGAGGATGATGGGACAGTGAGGACGCTGCAGATCAAGGTCAAAAGCGACGATGATCTGTACGAGTGGATAGACTTCATCTACGCGCGGTGCCCTGGTATGGGAGGAGTGAGCAACCCAACAAACTTCTCCCATGCAGTGCACGTCGGATTCGACCCCCAGACTGGCGAGTTTGTTGGCTTGCCACCAGAGTGGTCCAAGCTATTGAACTCCTCCGCCATTACCAAGGAAGATTATGAGAGGAATCCTCAAGCCGTGTTTGAAGTTCTAGATTTCTACTCAGACCTCACCAAGCGTAACGATAACCCCGCTCAGTACTCGAGTCTCACCCCGACGCCCCCGGCCGGCGCCATGCCAAACAAGCAACTAGGCTACAGTACCGGAGCGAACGTTGCTCCCCCGAGgcagatgcagcagcagcagcagcctatgcagcGCACTAACAACTATCCAAACATGTCTGGTGGTGGGTTACCGCCCAACGCATCTGGTGCCCGTGGGCCTTCCCCGCCCGATCCCCAGCAGCAGCAGAGGCAGCAGATGCAGAACATGTCTTCTAATTATATCAATCAAGGGGATCCGAACCGTGACGCGGAACGGCAGAGGCAGGCCGAGGCAGCTCAGCGACAGCGCATGATGGAGATCGAGGAGCAGAACCGTCGCGATCTCGAGGCCTACAATGCTTCTATTCCGCAGACGAAGAAGCCGATAGCACAGCAAGAGATCGGTGGGTACGGCGGAGCGCCTTCTTCATCTGCAGACCGTTTCAACCCCAACAGGGCACCTCCTCCTGCGCCCAAGCCTACAGCTCAACAATCCAACCTCCAAGCACAGCGTCCTGCTCCACGAGCCCCGAACGCCGCCGGTGGTCCACGACCTGGAATCTCGCAACAAAACAGTTCACAAAACGTGCGGGATCCTGCATCACAGCAACAACAGCGTGTCCCACCTCGCAACGACCAGTCCCCGAATGCGCAGAGGTATCCCAACGGTGGACCCGCACCCCAGCCTCGCACCAACGGTCAACCCCAGAACCAACAGCCATCGCGCTTGCCTGCGCCTGTTAAACCTCTCAATGTCGCGCCCAAGCCTGCAGCGCAATCTGATGCAGTCAGGGCGGCTGAGGCTGCGTTGACTGCGAAGCCGCCCGCACAGGAGCGGCAGAAGGACGTCCGCATGTCAACCATGTCGGAAACCGAGGTTATGGCTAAACTCAAGGAGGCCGTCTCAAAGGACGACCCGAACTTGTCGTACTCGAAGCAAAAGAAGATCGGTCAAGGAGCTTCCGGTTCGGTCTATGTGGCCAAGGTCAAGGAGACGGCAGTCTCCCCTATTGCTCGCGAGCTTCTTCGCGAGCAAGGCTCTAGGGCTCAGGTCGCCATCAAGCAAATGGACCTGGCTCACCAGCCCCGTAAGGAACTTATTGTCAACGAAATCATGGTAATGAAGGACAGCACACACCGTAATATTGTCAACTACCTCGACGCATTTCTTCGAAACAACTACAGTGAGCTGTGGGTGGTTATGGAGTACATGGAGGGTGGCGCTTTAACCGACGTTATTGACAACAACCCTGTTATTACTGAGGAGCAAATCTCTACCATTTGCCTGGAGACTTGTCAGGGACTGCAGCACTTGCACTCGCAGAGCATCATCCACCGTGATATCAAGAGTGACAACGTGCTTCTGGATGCCAGGGGTAACGTCAAGATTACCGATTTTGGTTTTTGCGCAAAGCTCACCGAGTCCAAGTCGAAGCGAGCCACTATGGTCGGAACTCCTTACTGGATGGCGCCTGAGGTCGTCAAGCAGAAGGAGTACGGTCCCAAGGTTGATATTTGGTCTCTGGGTATCATGGCGATAGAGATGATCGAATCCGAACCGCCGTACTTGAACGAGGAGCCTCTCAAGGCGCTGTATCTGATTGCTACTAACGGGACACCTCGCCTCAAGAACCCGGCCAAGCTGAGCAAAGAGCTGAAGGCTTTCTTGTCTGTCTGCCTCTGTGTCGATGTCAAGAGTCGAGCATCTGCCAAGGAACTTCTTGAACATGACTTCTTGAAGCATGGTTGCCCTCTAGGTAGCTTGTCTGACCTCCTCGCCTTCAAGAAGCATGCCAAATAA


Protein sequences

Name Description Sequence
Mgr.116 translated coding region predicted by ESTScan from UniGene Mgr.116

MNPGPAPRPPTDRPRLNLTPSQNLPGNMANMSLNSPGMGRGQFGGGSSVYGGSTISLPLSRAASNTDGLGGVAVIKEGWAQVKESKNFINPWKQKYLILRKEALDFHKQEGSKSSYTLYLKDVINVGRVEAAGTIFEVKRQSNGTSTSPGEDDGTVRTLQIKVKSDDDLYEWIDFIYARCPGMGGVSNPTNFSHAVHVGFDPQTGEFVGLPPEWSKLLNSSAITKEDYERNPQAVFEVLDFYSDLTKRNDNPAQYSSLTPTPPAGAMPNKQLGYSTGANVAPPRQMQQQQQPMQRTNNYPNMSGGGLPPNASGARGPSPPDPQQQQRQQMQNMSSNYINQGDPNRDAERQRQAEAAQRQRMMEIEEQNRRDLEAYNASIPQTKKPIAQQEIGGYGGAPSSSADRFNPNRAPPPAPKPTAQQSNLQAQRPAPRAPNAAGGPRPGISQQNSSQNVRDPASQQQQRVPPRNDQSPNAQRYPNGGPAPQPRTNGQPQNQQPSRLPAPVKPLNVAPKPAAQSDAVRAAEAALTAKPPAQERQKDVRMSTMSETEVMAKLKEAVSKDDPNLSYSKQKKIGQGASGSVYVAKVKETAVSPIARELLREQGSRAQVAIKQMDLAHQPRKELIVNEIMVMKDSTHRNIVNYLDAFLRNNYSELWVVMEYMEGGALTDVIDNNPVITEEQISTICLETCQGLQHLHSQSIIHRDIKSDNVLLDARGNVKITDFGFCAKLTESKSKRATMVGTPYWMAPEVVKQKEYGPKVDIWSLGIMAIEMIESEPPYLNEEPLKALYLIATNGTPRLKNPAKLSKELKAFLSVCLCVDVKSRASAKELLEHDFLKHGCPLGSLSDLLAFKKHAK

Domains

Domain Start-End Description Sequence

ProfileScan: PS50003
IPR001849
73-181 PH_DOMAIN
Pleckstrin homology domain

AVIKEGWAQVKESKNFINPWKQKYLILRKEALDFHKQEGSKSSYTLYLKDVINVGRVEAAGTIFEVKRQSNGTSTSPGEDDGTVRTLQIKVKSDDDLYEWIDFIYARCP

Gene3D: G3DSA:2.30.29.30
IPR011993
74-177 PH_type
Pleckstrin homology-like domain

VIKEGWAQVKESKNFINPWKQKYLILRKEALDFHKQEGSKSSYTLYLKDVINVGRVEAAGTIFEVKRQSNGTSTSPGEDDGTVRTLQIKVKSDDDLYEWIDFIY

superfamily: SSF50729
74-197 SSF50729

VIKEGWAQVKESKNFINPWKQKYLILRKEALDFHKQEGSKSSYTLYLKDVINVGRVEAAGTIFEVKRQSNGTSTSPGEDDGTVRTLQIKVKSDDDLYEWIDFIYARCPGMGGVSNPTNFSHAVH

HMMSmart: SM00233
IPR001849
74-183 PH
Pleckstrin homology domain

VIKEGWAQVKESKNFINPWKQKYLILRKEALDFHKQEGSKSSYTLYLKDVINVGRVEAAGTIFEVKRQSNGTSTSPGEDDGTVRTLQIKVKSDDDLYEWIDFIYARCPGM

HMMPanther: PTHR24361:SF84
137-849 PTHR24361:SF84

EVKRQSNGTSTSPGEDDGTVRTLQIKVKSDDDLYEWIDFIYARCPGMGGVSNPTNFSHAVHVGFDPQTGEFVGLPPEWSKLLNSSAITKEDYERNPQAVFEVLDFYSDLTKRNDNPAQYSSLTPTPPAGAMPNKQLGYSTGANVAPPRQMQQQQQPMQRTNNYPNMSGGGLPPNASGARGPSPPDPQQQQRQQMQNMSSNYINQGDPNRDAERQRQAEAAQRQRMMEIEEQNRRDLEAYNASIPQTKKPIAQQEIGGYGGAPSSSADRFNPNRAPPPAPKPTAQQSNLQAQRPAPRAPNAAGGPRPGISQQNSSQNVRDPASQQQQRVPPRNDQSPNAQRYPNGGPAPQPRTNGQPQNQQPSRLPAPVKPLNVAPKPAAQSDAVRAAEAALTAKPPAQERQKDVRMSTMSETEVMAKLKEAVSKDDPNLSYSKQKKIGQGASGSVYVAKVKETAVSPIARELLREQGSRAQVAIKQMDLAHQPRKELIVNEIMVMKDSTHRNIVNYLDAFLRNNYSELWVVMEYMEGGALTDVIDNNPVITEEQISTICLETCQGLQHLHSQSIIHRDIKSDNVLLDARGNVKITDFGFCAKLTESKSKRATMVGTPYWMAPEVVKQKEYGPKVDIWSLGIMAIEMIESEPPYLNEEPLKALYLIATNGTPRLKNPAKLSKELKAFLSVCLCVDVKSRASAKELLEHDFLKHGCPLGSLSDLL

HMMPanther: PTHR24361
137-849 PTHR24361,MITOGEN-ACTIVATED KINASE KINASE KINASE

EVKRQSNGTSTSPGEDDGTVRTLQIKVKSDDDLYEWIDFIYARCPGMGGVSNPTNFSHAVHVGFDPQTGEFVGLPPEWSKLLNSSAITKEDYERNPQAVFEVLDFYSDLTKRNDNPAQYSSLTPTPPAGAMPNKQLGYSTGANVAPPRQMQQQQQPMQRTNNYPNMSGGGLPPNASGARGPSPPDPQQQQRQQMQNMSSNYINQGDPNRDAERQRQAEAAQRQRMMEIEEQNRRDLEAYNASIPQTKKPIAQQEIGGYGGAPSSSADRFNPNRAPPPAPKPTAQQSNLQAQRPAPRAPNAAGGPRPGISQQNSSQNVRDPASQQQQRVPPRNDQSPNAQRYPNGGPAPQPRTNGQPQNQQPSRLPAPVKPLNVAPKPAAQSDAVRAAEAALTAKPPAQERQKDVRMSTMSETEVMAKLKEAVSKDDPNLSYSKQKKIGQGASGSVYVAKVKETAVSPIARELLREQGSRAQVAIKQMDLAHQPRKELIVNEIMVMKDSTHRNIVNYLDAFLRNNYSELWVVMEYMEGGALTDVIDNNPVITEEQISTICLETCQGLQHLHSQSIIHRDIKSDNVLLDARGNVKITDFGFCAKLTESKSKRATMVGTPYWMAPEVVKQKEYGPKVDIWSLGIMAIEMIESEPPYLNEEPLKALYLIATNGTPRLKNPAKLSKELKAFLSVCLCVDVKSRASAKELLEHDFLKHGCPLGSLSDLL

Gene3D: G3DSA:3.90.810.10
185-255 G3DSA:3.90.810.10

GVSNPTNFSHAVHVGFDPQTGEFVGLPPEWSKLLNSSAITKEDYERNPQAVFEVLDFYSDLTKRNDNPAQY

ProfileScan: PS50108
IPR000095
186-199 CRIB
PAK-box/P21-Rho-binding

VSNPTNFSHAVHVG

HMMPfam: PF00786
IPR000095
186-243 PBD
PAK-box/P21-Rho-binding

VSNPTNFSHAVHVGFDPQTGEFVGLPPEWSKLLNSSAITKEDYERNPQAVFEVLDFYS

HMMSmart: SM00285
IPR000095
186-221 PBD
PAK-box/P21-Rho-binding

VSNPTNFSHAVHVGFDPQTGEFVGLPPEWSKLLNSS

Gene3D: G3DSA:3.30.200.20
436-475 G3DSA:3.30.200.20

AAGGPRPGISQQNSSQNVRDPASQQQQRVPPRNDQSPNAQ

Gene3D: G3DSA:3.30.200.20
534-535 G3DSA:3.30.200.20

QE

superfamily: SSF56112
IPR011009
553-837 Kinase_like
Protein kinase-like domain

KLKEAVSKDDPNLSYSKQKKIGQGASGSVYVAKVKETAVSPIARELLREQGSRAQVAIKQMDLAHQPRKELIVNEIMVMKDSTHRNIVNYLDAFLRNNYSELWVVMEYMEGGALTDVIDNNPVITEEQISTICLETCQGLQHLHSQSIIHRDIKSDNVLLDARGNVKITDFGFCAKLTESKSKRATMVGTPYWMAPEVVKQKEYGPKVDIWSLGIMAIEMIESEPPYLNEEPLKALYLIATNGTPRLKNPAKLSKELKAFLSVCLCVDVKSRASAKELLEHDFLK

ProfileScan: PS50011
IPR000719
567-836 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YSKQKKIGQGASGSVYVAKVKETAVSPIARELLREQGSRAQVAIKQMDLAHQPRKELIVNEIMVMKDSTHRNIVNYLDAFLRNNYSELWVVMEYMEGGALTDVIDNNPVITEEQISTICLETCQGLQHLHSQSIIHRDIKSDNVLLDARGNVKITDFGFCAKLTESKSKRATMVGTPYWMAPEVVKQKEYGPKVDIWSLGIMAIEMIESEPPYLNEEPLKALYLIATNGTPRLKNPAKLSKELKAFLSVCLCVDVKSRASAKELLEHDFL

HMMPfam: PF00069
IPR017442
567-836 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

YSKQKKIGQGASGSVYVAKVKETAVSPIARELLREQGSRAQVAIKQMDLAHQPRKELIVNEIMVMKDSTHRNIVNYLDAFLRNNYSELWVVMEYMEGGALTDVIDNNPVITEEQISTICLETCQGLQHLHSQSIIHRDIKSDNVLLDARGNVKITDFGFCAKLTESKSKRATMVGTPYWMAPEVVKQKEYGPKVDIWSLGIMAIEMIESEPPYLNEEPLKALYLIATNGTPRLKNPAKLSKELKAFLSVCLCVDVKSRASAKELLEHDFL

Gene3D: G3DSA:3.30.200.20
567-689 G3DSA:3.30.200.20

YSKQKKIGQGASGSVYVAKVKETAVSPIARELLREQGSRAQVAIKQMDLAHQPRKELIVNEIMVMKDSTHRNIVNYLDAFLRNNYSELWVVMEYMEGGALTDVIDNNPVITEEQISTICLETC

HMMSmart: SM00220
IPR002290
567-836 S_TKc
Serine/threonine- / dual-specificity protein kinas

YSKQKKIGQGASGSVYVAKVKETAVSPIARELLREQGSRAQVAIKQMDLAHQPRKELIVNEIMVMKDSTHRNIVNYLDAFLRNNYSELWVVMEYMEGGALTDVIDNNPVITEEQISTICLETCQGLQHLHSQSIIHRDIKSDNVLLDARGNVKITDFGFCAKLTESKSKRATMVGTPYWMAPEVVKQKEYGPKVDIWSLGIMAIEMIESEPPYLNEEPLKALYLIATNGTPRLKNPAKLSKELKAFLSVCLCVDVKSRASAKELLEHDFL

Gene3D: G3DSA:1.10.510.10
690-838 G3DSA:1.10.510.10

QGLQHLHSQSIIHRDIKSDNVLLDARGNVKITDFGFCAKLTESKSKRATMVGTPYWMAPEVVKQKEYGPKVDIWSLGIMAIEMIESEPPYLNEEPLKALYLIATNGTPRLKNPAKLSKELKAFLSVCLCVDVKSRASAKELLEHDFLKH

PatternScan: PS00108
IPR008271
700-712 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDIKSDNVLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox