PRGDB00071112 (Mgr.3150)

From PRG Wiki
Jump to: navigation, search
Mgr.3150
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145611359 (XM_368797)
Gene Class CN
Domain Type NBS
Gene Species Magnaporthe grisea

Comment?

Magnaporthe grisea 70-15 hypothetical protein (MGG_00447) partial mRNA

DNA Sequence

ATGGACCAAAAAGCCAATGATGTCGCAAGCCTGGAGGAGGGCAACAAGGCCCCCTCAACAGCCAACACAGCTGTCGGCTCGCTACCGCGTTCGGCCGATCCAAGCATCAACCTCGAGGAGTTGCGCGTGGCAGCTCACCAGAAGAACCCCAACGGCACCTCCAATGTTGGCTCCGGCATCTCAGTGGCCCGGGCCGAGGCCGACTTCGCCGAGCTGCAGAGGGAGCTCACGGGAATGTCCAGAGCCAGCCGGCGCAAGAGCCACGCCTCTCAGCGTGATGCTGAGAAGGCCAATGGCGAAGACCTGGGAGAGACATCATCTTCTGAAAGCGAACCATTTGATTTGGAGTCGTGGATTCGTGGAGGGATTCAGGCTGAGCGCGAGGCTGGCATCCGTCCCAAGCACATCGGGGTTTATTGGGATGAACTAACGGTCAAGGGAATGAGCGCATTCACAAACTACGTTGAAACATTTCCCGATGCAGTCATCCGATTCTTCGACTATTACACCCCCATCAAGAACAAGTTGGGCCTGGGAGGCAAGGCGCCTGAGGCCACCCTGCTCGACAGCTTCCGTGGTGTCTGCAAGCCCGGTGAGATGGTTCTGGTCTTGGGCAAACCGGGATCCGGCTGCACAACCTTCCTCAAGAACATCACCAACCAGCGCTACGGCTACACTGGTGTGGAAGGTGATGTGCTTTATGGTCCTTTCACCGCCAAGGAGTTTGAGAAATATCGCGGAGAGGCCGTCTACAACCAGGAGGACGACATCCACCACGCGACCCTGACGGTGGAGCAGACGCTCGGCTTTGCGCTCGACTGCAAAGTTCCCGGCAAGCTTCCGGCTGGCATCACCAAGGCGCAGTTCAAGAAGGACGTCATTACCATGTTACTCAAGATGTTCAACATTGAGCATACCCGCAACACTGTCGTTGGTGGCTCCCTTGTGCGCGGTGTGTCTGGAGGCGAGAGGAAACGTGTTTCTGTTGCCGAGATGATGATTACGTCAGGATCTATTCTTGCCTGGGACAACAGCACTCGCGGTCTCGATGCCAGTACTGCTCTGGACTTCATCAAGTCGCTGCGTATCCAGACCAACCTCTACAAGACCGCGACGTTCGTCTCGCTATACCAAGCTTCGGAGAACATCTACAAGTTGTTTGACAAGGTGCTTGTCATTGACGCTGGCCGGCAAGTGTACTTCGGCCCCGCTACCGAGGCCCGTGGATACTTTGAAGGCCTCGGTTTCCTTCCCAGGCCCCGACAGACTACCCCCGACTACGTCACTGGCTGTACCGACGAATACGAGCGCGCCTACTCGGAAGGCTACAGTCCCGACAACGCTCCGCACAGCCCCGAGACTCTGGCCGAGGCTTTCAAGAAGTCCGACTTCGCGAAGAGGTTGGATAACGAGATGGTAGAATACCGCGAGTCTCTGAAAGAGGACCAGCAAAAGTACGAGGATTTCAAGATTGCTGTTAAGGAAGGCAAGCGCACAGGTGCCAAGAAGTCGGTTTACACTGTTGGCTTCCACCGCCAGGTCTGGGCGCTTATGAAGCGTCAGACTGTGCTCAAGCTGCAAGATCGAATGGCCTTGTTCCTCGCATGGATGCGGACCATTCTCATCGCCATCGTCGTCGGTACACTCTACATCAACCTCGGTCAAACCAGCGCCACTTCCTTCAGCAAGGGTGGTCTGATGTTTATCTCTCTCCTGTTCAACGCTTTCGAGGCATTTGCTGAGCTCGGCTCAACCATGCTGGGTCGTGGCATCGTCAACAAGCACAAGGCTTATGCTTTCCATCGGCCGAGTGCACTTTGGATTGGTCAAATCTTTGTCGATCAGGCCTTTGGTGTGCCCAGGGTTCTCGCCTTTTCCATCATTGTATATTTTATGACCAACTTGTTCCGCAGCGCGGGCGCCTTCTTCATGTTTTTCTTGTTCATCATGCTTGGAAACATTGCGATGACGCTCTTTTTCCGAATCATTGGTTGCATCTCGATCGATTTCGACTATGCTGTCAAGTTTGCTGTCGTCACGATCACGCTGCTTATCACAACATCCGGTTACATCATTCAGTACCAGTCACAACAGGTCTGGCTGCGTTGGATTTTCTGGATCAACCCTCTGGGTCTGATGTTCAGCTCCATGATGGGCAATGAATTCAGCAGAATAGATATGACCTGCACAGCAGAGAGTCTCATTCCGTCCGGACCAGGGTACAACAACCCCGAGAACCAGGTCTGCACTCTGCCTGGGTCTAAGCCAGGCAGCCTCGAAGTCTCGGGCTCGGACTACATTCGTACAGGCTTCGCCTACGACCCGAACGACATCTGGCGCAACTTTGGCATTGTCATGGGCCTTGTTGCCTTCTTCTTGATCATGAATGTCGTCCTGGGAGAGGTTATCGAATTCGGAATGGGAGGTAACTCGGCCTTGGTTTACCAGAAACCCAACAAGGAGCGGAAGGAGCTCAACGAAAAACTCGTGGCCAAGCGTGAGGCTCAACGTTCTTCCAAGTCTGAGGCTCAAGGTTCGGATCTCAAGATTGAGTCCAAGAGAGTTTTGACTTGGGAGAACCTGACCTACGACGTCCCTGTCCCCGGAGGCAACCGCCGGTTGCTCAACAATGTGTTTGGATATGTCAAGCCTGGTCAACTGACGGCTCTCATGGGTGCATCTGGCGCTGGAAAGACTACCCTGCTTGATGTTCTTGCTTCCAGGAAGAACATTGGTGTCATCGGTGGTGACATTTTGGTCGACGGAAAGAAGCCTGGAAAGGAGTTCCAGCGTTCGACGTCGTATGCCGAGCAGCTTGATGTGCACGAGCCCACACAGACCGTCCGGGAGGCCCTGAGGTTCTCTGCCGATCTCAGGCAGCCTTTTGATACCCCCCAGGAAGAGAAATACGCTTTTGTCGAGGAGATGATCACTTTGTTGGAGCTTGAGGATTTGGCAGATTCCATCATTGGATGGCCCGAATTCGGCCTTACTGTTGAACAACGCAAGCGTGTGACAATCGGCGTCGAACTTGCCGCCAAGCCCGAGCTGCTTTTGTTCCTGGATGAGCCCACGTCCGGTCTCGACAGCCAGAGTGCCTTCAACATTGTGCGCTTCCTCAAGAAGCTCGCAAACGCTGGCCAGGCTATTCTCTGCACCATCCACCAGCCCAACTCGGCCCTCTTCGAGAACTTTGACCGTCTTTTGCTGCTTCAGCGCGGTGGCCGCTGCGTGTACTTTGGTGACATTGGCAAGGATGCCAATGTCCTCCGTGATTACCTCAAGCGTCATGGCGCCGAGGCCTCGCCCACCGACAACGTTGCTGAGTATATGCTTGAGGCCGTTGGTGCCGGTAGCGCTCCTCGTGTTGGCGACCGTGATTGGGCAGACATCTGGGAGGAGTCTCCCGAGCATGCCAACGTCAAGGATACCATTTCTCAGCTCAAGGAAGAGCGCAAGGCAGAGGTGGCCAACGATAGCAATTCGGCACTCGAAAAGGAATACGCCTCGCCAATAAGCCACCAACTCAAAGTAACCTCCCATCGTACCAACCTCGCGTTGTGGCGTTCTCCGAACTACCTCTTCACCCGTCTGTTCAACCATGTCGTCATTGCTATCGTTACTGGACTCACCTACCTGCAGCTCGACAACTCGCGGTCTTCTCTTCAGTACAAGGTCTTTATCATGTTCCAAGTCACTGTCCTGCCTGCTCTGATTCTGTCTCAGGTCGAGGCCATGTATCACGTCAAGCGCGGCATTTTCTTCCGCGAGTCCTCATCCAAGATGTACAACACTAGCGCCTTCGCTGCCTCCATGCTCCTTGCAGAGCTGCCATACGTCGTCCTGTGTGCTGTGGCCTTCTTCCTCCCTCTCTACTACATGCCAGGCTTCACCTACGACAGCTCGAGAGCTGGATACCAGTTCCTCATGATCCTCATCACCGAGTTCTTTTCCATCACCCTCGCTCAGGCCTTGTCTTCCATCACGCCGTCGACTTTCATCTCTAGCCAGTTGGATCCATTCTTGATGATTACCTTCTCGTTGTTCTGCGGTGTTACCATTCCGTTCCCCCAGATGCCCGATGGATACAAGTGGTTATACCAGCTGGACCCTTTCACTCGGCTTATCGGCGGTATGGTTACGACTGCTTTGCATGACCTCGACGTCAAATGCGCCTCGATCGAGCTGAACAAGTTTACGCCCGCGAACGGTAGCACATGCGAAGAGTACATGAGGCCGTTCTTCAACGCCGGCGGCAATGGATATATTGTAGACCCCAGCTCGACCGCTCAGTGCGATTACTGCGCTTACAGCAGTGGAGACCAATTCTACACGCCACTCGGCATGACGTTTGATAACAGGTGGAGAGACTTGGGCATCTACCTCGCATTTTGCGCGAGCAACATCGTTATCATTTTCGTGGCTAACCGTTTCCTGAACTTCAACAAGCGATAA


Protein sequences

Name Description Sequence
Mgr.3150 translated coding region predicted by ESTScan from UniGene Mgr.3150

MDQKANDVASLEEGNKAPSTANTAVGSLPRSADPSINLEELRVAAHQKNPNGTSNVGSGISVARAEADFAELQRELTGMSRASRRKSHASQRDAEKANGEDLGETSSSESEPFDLESWIRGGIQAEREAGIRPKHIGVYWDELTVKGMSAFTNYVETFPDAVIRFFDYYTPIKNKLGLGGKAPEATLLDSFRGVCKPGEMVLVLGKPGSGCTTFLKNITNQRYGYTGVEGDVLYGPFTAKEFEKYRGEAVYNQEDDIHHATLTVEQTLGFALDCKVPGKLPAGITKAQFKKDVITMLLKMFNIEHTRNTVVGGSLVRGVSGGERKRVSVAEMMITSGSILAWDNSTRGLDASTALDFIKSLRIQTNLYKTATFVSLYQASENIYKLFDKVLVIDAGRQVYFGPATEARGYFEGLGFLPRPRQTTPDYVTGCTDEYERAYSEGYSPDNAPHSPETLAEAFKKSDFAKRLDNEMVEYRESLKEDQQKYEDFKIAVKEGKRTGAKKSVYTVGFHRQVWALMKRQTVLKLQDRMALFLAWMRTILIAIVVGTLYINLGQTSATSFSKGGLMFISLLFNAFEAFAELGSTMLGRGIVNKHKAYAFHRPSALWIGQIFVDQAFGVPRVLAFSIIVYFMTNLFRSAGAFFMFFLFIMLGNIAMTLFFRIIGCISIDFDYAVKFAVVTITLLITTSGYIIQYQSQQVWLRWIFWINPLGLMFSSMMGNEFSRIDMTCTAESLIPSGPGYNNPENQVCTLPGSKPGSLEVSGSDYIRTGFAYDPNDIWRNFGIVMGLVAFFLIMNVVLGEVIEFGMGGNSALVYQKPNKERKELNEKLVAKREAQRSSKSEAQGSDLKIESKRVLTWENLTYDVPVPGGNRRLLNNVFGYVKPGQLTALMGASGAGKTTLLDVLASRKNIGVIGGDILVDGKKPGKEFQRSTSYAEQLDVHEPTQTVREALRFSADLRQPFDTPQEEKYAFVEEMITLLELEDLADSIIGWPEFGLTVEQRKRVTIGVELAAKPELLLFLDEPTSGLDSQSAFNIVRFLKKLANAGQAILCTIHQPNSALFENFDRLLLLQRGGRCVYFGDIGKDANVLRDYLKRHGAEASPTDNVAEYMLEAVGAGSAPRVGDRDWADIWEESPEHANVKDTISQLKEERKAEVANDSNSALEKEYASPISHQLKVTSHRTNLALWRSPNYLFTRLFNHVVIAIVTGLTYLQLDNSRSSLQYKVFIMFQVTVLPALILSQVEAMYHVKRGIFFRESSSKMYNTSAFAASMLLAELPYVVLCAVAFFLPLYYMPGFTYDSSRAGYQFLMILITEFFSITLAQALSSITPSTFISSQLDPFLMITFSLFCGVTIPFPQMPDGYKWLYQLDPFTRLIGGMVTTALHDLDVKCASIELNKFTPANGSTCEEYMRPFFNAGGNGYIVDPSSTAQCDYCAYSSGDQFYTPLGMTFDNRWRDLGIYLAFCASNIVIIFVANRFLNFNKR

Domains

Domain Start-End Description Sequence

Coil: coil
62-83 coiled-coil

VARAEADFAELQRELTGMSRAS

ProfileScan: PS50893
IPR003439
163-420 ABC_TRANSPORTER_2
ABC transporter-like

IRFFDYYTPIKNKLGLGGKAPEATLLDSFRGVCKPGEMVLVLGKPGSGCTTFLKNITNQRYGYTGVEGDVLYGPFTAKEFEKYRGEAVYNQEDDIHHATLTVEQTLGFALDCKVPGKLPAGITKAQFKKDVITMLLKMFNIEHTRNTVVGGSLVRGVSGGERKRVSVAEMMITSGSILAWDNSTRGLDASTALDFIKSLRIQTNLYKTATFVSLYQASENIYKLFDKVLVIDAGRQVYFGPATEARGYFEGLGFLPRP

superfamily: SSF52540
183-424 P-loop containing nucleoside triphosphate hydrolases

PEATLLDSFRGVCKPGEMVLVLGKPGSGCTTFLKNITNQRYGYTGVEGDVLYGPFTAKEFEKYRGEAVYNQEDDIHHATLTVEQTLGFALDCKVPGKLPAGITKAQFKKDVITMLLKMFNIEHTRNTVVGGSLVRGVSGGERKRVSVAEMMITSGSILAWDNSTRGLDASTALDFIKSLRIQTNLYKTATFVSLYQASENIYKLFDKVLVIDAGRQVYFGPATEARGYFEGLGFLPRPRQTT

Gene3D: G3DSA:3.40.50.300
183-407 no description

PEATLLDSFRGVCKPGEMVLVLGKPGSGCTTFLKNITNQRYGYTGVEGDVLYGPFTAKEFEKYRGEAVYNQEDDIHHATLTVEQTLGFALDCKVPGKLPAGITKAQFKKDVITMLLKMFNIEHTRNTVVGGSLVRGVSGGERKRVSVAEMMITSGSILAWDNSTRGLDASTALDFIKSLRIQTNLYKTATFVSLYQASENIYKLFDKVLVIDAGRQVYFGPATEA

HMMSmart: SM00382
IPR003593
197-421 ATPases associated with a variety of cellula,NBS
AAA+ ATPase domain

PGEMVLVLGKPGSGCTTFLKNITNQRYGYTGVEGDVLYGPFTAKEFEKYRGEAVYNQEDDIHHATLTVEQTLGFALDCKVPGKLPAGITKAQFKKDVITMLLKMFNIEHTRNTVVGGSLVRGVSGGERKRVSVAEMMITSGSILAWDNSTRGLDASTALDFIKSLRIQTNLYKTATFVSLYQASENIYKLFDKVLVIDAGRQVYFGPATEARGYFEGLGFLPRPR

HMMPfam: PF00005
IPR003439
240-346 ABC_tran
ABC transporter-like

KEFEKYRGEAVYNQEDDIHHATLTVEQTLGFALDCKVPGKLPAGITKAQFKKDVITMLLKMFNIEHTRNTVVGGSLVRGVSGGERKRVSVAEMMITSGSILAWDNST

Seg: seg
310-322 seg

VVGGSLVRGVSGG

PatternScan: PS00211
IPR017871
319-333 ABC_TRANSPORTER_1
ABC transporter, conserved site

VSGGERKRVSVAEMM

HMMPanther: PTHR19241:SF14
348-1484 ATP-BINDING CASSETTE TRANSPORTER SUBFAMILY G,ATP-BINDING CASSETTE TRANSPORTER SUBFAMILY G

GLDASTALDFIKSLRIQTNLYKTATFVSLYQASENIYKLFDKVLVIDAGRQVYFGPATEARGYFEGLGFLPRPRQTTPDYVTGCTDEYERAYSEGYSPDNAPHSPETLAEAFKKSDFAKRLDNEMVEYRESLKEDQQKYEDFKIAVKEGKRTGAKKSVYTVGFHRQVWALMKRQTVLKLQDRMALFLAWMRTILIAIVVGTLYINLGQTSATSFSKGGLMFISLLFNAFEAFAELGSTMLGRGIVNKHKAYAFHRPSALWIGQIFVDQAFGVPRVLAFSIIVYFMTNLFRSAGAFFMFFLFIMLGNIAMTLFFRIIGCISIDFDYAVKFAVVTITLLITTSGYIIQYQSQQVWLRWIFWINPLGLMFSSMMGNEFSRIDMTCTAESLIPSGPGYNNPENQVCTLPGSKPGSLEVSGSDYIRTGFAYDPNDIWRNFGIVMGLVAFFLIMNVVLGEVIEFGMGGNSALVYQKPNKERKELNEKLVAKREAQRSSKSEAQGSDLKIESKRVLTWENLTYDVPVPGGNRRLLNNVFGYVKPGQLTALMGASGAGKTTLLDVLASRKNIGVIGGDILVDGKKPGKEFQRSTSYAEQLDVHEPTQTVREALRFSADLRQPFDTPQEEKYAFVEEMITLLELEDLADSIIGWPEFGLTVEQRKRVTIGVELAAKPELLLFLDEPTSGLDSQSAFNIVRFLKKLANAGQAILCTIHQPNSALFENFDRLLLLQRGGRCVYFGDIGKDANVLRDYLKRHGAEASPTDNVAEYMLEAVGAGSAPRVGDRDWADIWEESPEHANVKDTISQLKEERKAEVANDSNSALEKEYASPISHQLKVTSHRTNLALWRSPNYLFTRLFNHVVIAIVTGLTYLQLDNSRSSLQYKVFIMFQVTVLPALILSQVEAMYHVKRGIFFRESSSKMYNTSAFAASMLLAELPYVVLCAVAFFLPLYYMPGFTYDSSRAGYQFLMILITEFFSITLAQALSSITPSTFISSQLDPFLMITFSLFCGVTIPFPQMPDGYKWLYQLDPFTRLIGGMVTTALHDLDVKCASIELNKFTPANGSTCEEYMRPFFNAGGNGYIVDPSSTAQCDYCAYSSGDQFYTPLGMTFDNRWRDLGIYLAFCASNIVIIFVANRFLNFNKR

HMMPanther: PTHR19241
348-1484 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

GLDASTALDFIKSLRIQTNLYKTATFVSLYQASENIYKLFDKVLVIDAGRQVYFGPATEARGYFEGLGFLPRPRQTTPDYVTGCTDEYERAYSEGYSPDNAPHSPETLAEAFKKSDFAKRLDNEMVEYRESLKEDQQKYEDFKIAVKEGKRTGAKKSVYTVGFHRQVWALMKRQTVLKLQDRMALFLAWMRTILIAIVVGTLYINLGQTSATSFSKGGLMFISLLFNAFEAFAELGSTMLGRGIVNKHKAYAFHRPSALWIGQIFVDQAFGVPRVLAFSIIVYFMTNLFRSAGAFFMFFLFIMLGNIAMTLFFRIIGCISIDFDYAVKFAVVTITLLITTSGYIIQYQSQQVWLRWIFWINPLGLMFSSMMGNEFSRIDMTCTAESLIPSGPGYNNPENQVCTLPGSKPGSLEVSGSDYIRTGFAYDPNDIWRNFGIVMGLVAFFLIMNVVLGEVIEFGMGGNSALVYQKPNKERKELNEKLVAKREAQRSSKSEAQGSDLKIESKRVLTWENLTYDVPVPGGNRRLLNNVFGYVKPGQLTALMGASGAGKTTLLDVLASRKNIGVIGGDILVDGKKPGKEFQRSTSYAEQLDVHEPTQTVREALRFSADLRQPFDTPQEEKYAFVEEMITLLELEDLADSIIGWPEFGLTVEQRKRVTIGVELAAKPELLLFLDEPTSGLDSQSAFNIVRFLKKLANAGQAILCTIHQPNSALFENFDRLLLLQRGGRCVYFGDIGKDANVLRDYLKRHGAEASPTDNVAEYMLEAVGAGSAPRVGDRDWADIWEESPEHANVKDTISQLKEERKAEVANDSNSALEKEYASPISHQLKVTSHRTNLALWRSPNYLFTRLFNHVVIAIVTGLTYLQLDNSRSSLQYKVFIMFQVTVLPALILSQVEAMYHVKRGIFFRESSSKMYNTSAFAASMLLAELPYVVLCAVAFFLPLYYMPGFTYDSSRAGYQFLMILITEFFSITLAQALSSITPSTFISSQLDPFLMITFSLFCGVTIPFPQMPDGYKWLYQLDPFTRLIGGMVTTALHDLDVKCASIELNKFTPANGSTCEEYMRPFFNAGGNGYIVDPSSTAQCDYCAYSSGDQFYTPLGMTFDNRWRDLGIYLAFCASNIVIIFVANRFLNFNKR

Coil: coil
465-486 coiled-coil

AKRLDNEMVEYRESLKEDQQKY

HMMPfam: PF01061
IPR013525
512-722 ABC2_membrane
ABC-2 type transporter

RQVWALMKRQTVLKLQDRMALFLAWMRTILIAIVVGTLYINLGQTSATSFSKGGLMFISLLFNAFEAFAELGSTMLGRGIVNKHKAYAFHRPSALWIGQIFVDQAFGVPRVLAFSIIVYFMTNLFRSAGAFFMFFLFIMLGNIAMTLFFRIIGCISIDFDYAVKFAVVTITLLITTSGYIIQYQSQQVWLRWIFWINPLGLMFSSMMGNEF

HMMPfam: PF06422
IPR010929
734-828 PDR_CDR
CDR ABC transporter

LIPSGPGYNNPENQVCTLPGSKPGSLEVSGSDYIRTGFAYDPNDIWRNFGIVMGLVAFFLIMNVVLGEVIEFGMGGNSALVYQKPNKERKELNEK

Gene3D: G3DSA:3.40.50.300
852-1083 no description

SKRVLTWENLTYDVPVPGGNRRLLNNVFGYVKPGQLTALMGASGAGKTTLLDVLASRKNIGVIGGDILVDGKKPGKEFQRSTSYAEQLDVHEPTQTVREALRFSADLRQPFDTPQEEKYAFVEEMITLLELEDLADSIIGWPEFGLTVEQRKRVTIGVELAAKPELLLFLDEPTSGLDSQSAFNIVRFLKKLANAGQAILCTIHQPNSALFENFDRLLLLQRGGRCVYFGDI

superfamily: SSF52540
853-1085 P-loop containing nucleoside triphosphate hydrolases

KRVLTWENLTYDVPVPGGNRRLLNNVFGYVKPGQLTALMGASGAGKTTLLDVLASRKNIGVIGGDILVDGKKPGKEFQRSTSYAEQLDVHEPTQTVREALRFSADLRQPFDTPQEEKYAFVEEMITLLELEDLADSIIGWPEFGLTVEQRKRVTIGVELAAKPELLLFLDEPTSGLDSQSAFNIVRFLKKLANAGQAILCTIHQPNSALFENFDRLLLLQRGGRCVYFGDIGK

ProfileScan: PS50893
IPR003439
856-1098 ABC_TRANSPORTER_2
ABC transporter-like

LTWENLTYDVPVPGGNRRLLNNVFGYVKPGQLTALMGASGAGKTTLLDVLASRKNIGVIGGDILVDGKKPGKEFQRSTSYAEQLDVHEPTQTVREALRFSADLRQPFDTPQEEKYAFVEEMITLLELEDLADSIIGWPEFGLTVEQRKRVTIGVELAAKPELLLFLDEPTSGLDSQSAFNIVRFLKKLANAGQAILCTIHQPNSALFENFDRLLLLQRGGRCVYFGDIGKDANVLRDYLKRHG

HMMSmart: SM00382
IPR003593
884-1075 ATPases associated with a variety of cellula,NBS
AAA+ ATPase domain

PGQLTALMGASGAGKTTLLDVLASRKNIGVIGGDILVDGKKPGKEFQRSTSYAEQLDVHEPTQTVREALRFSADLRQPFDTPQEEKYAFVEEMITLLELEDLADSIIGWPEFGLTVEQRKRVTIGVELAAKPELLLFLDEPTSGLDSQSAFNIVRFLKKLANAGQAILCTIHQPNSALFENFDRLLLLQRGG

Seg: seg
911-922 seg

IGVIGGDILVDG

HMMPfam: PF01061
IPR013525
1175-1382 ABC2_membrane
ABC-2 type transporter

QLKVTSHRTNLALWRSPNYLFTRLFNHVVIAIVTGLTYLQLDNSRSSLQYKVFIMFQVTVLPALILSQVEAMYHVKRGIFFRESSSKMYNTSAFAASMLLAELPYVVLCAVAFFLPLYYMPGFTYDSSRAGYQFLMILITEFFSITLAQALSSITPSTFISSQLDPFLMITFSLFCGVTIPFPQMPDGYKWLYQLDPFTRLIGGMVTT






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox