PRGDB00071113 (Mgr.4475)

From PRG Wiki
Jump to: navigation, search
Mgr.4475
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145610748 (XM_368319)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Magnaporthe grisea

Comment?

Magnaporthe grisea 70-15 hypothetical protein (MGG_00925) partial mRNA

DNA Sequence

ATGGCCACCACCCAGACAACCCAAGGCCAGATACAACCTTGTAGATACAAGGTTGGAAAAACGCTGGGCGCAGGCTCATACTCAGTTGTGAAAGAATGTGTGCACATAGACACAGGGCGGTACTATGCAGCCAAAGTCATTAACAAACGATTGATGGCAGGACGCGAGCACATGGTTCGCAATGAAATCGCTGTTCTCAAGAAGGTGTCCATGGGGCATCAAAACATCCTTACGCTAGTGGATTACTTCGAGACCATGAACAATCTATACCTGGTGACAGACCTTGCTCTCGGCGGCGAACTTTTCGACAGGATCTGCCGAAAAGGTTCCTACTATGAATCAGACGCAGTGGACCTGATACGCGCGACACTTTCTGCCGTCGCATATCTGCATGACCACGGCATCGTTCACCGCGACCTCAAGCCGGAAAACCTACTTTTCCGAACGCCCGAGGACAATGCAGACCTTCTAATCGCTGACTTTGGCCTCTCGCGGATAATGGATGAGGAGCAGTTCCATGTGCTCACAACGACCTGTGGCACTCCCGGCTACATGGCGCCCGAGATCTTCAAGAAGACGGGACACGGTAAACCCGTAGACATCTGGGCCCTCGGCGTCATTACATACTTCCTCCTTTGTGGCTACACTCCATTCGATCGGGATAGCGACTTGGAGGAGATGCAGGCAATCCTCAATGCCGACTACAGCTTCACTCCGATTGAGTTCTGGCGCGGCGTCTCTGACTCGGCCAAGGACTTTATTAGGCGCTGCCTGACCATTGATCCCACTAAACGCATGTCGGCGCACGAGGCGCTTCAACACCCGTTCGTCGCCGGATATCTGGCAGACAAGGGTGCCAACCTACTACCGACAGTCAAGAAGAACTTCAACGCGCGCCGCACGCTACACGCCGCCATCGACACTGTGCGCGCCATCAACAAGCTCCGTGAAGGCCAGGGTCTCAATGGCCAGCGGTTGATGGCTGGGGTCAAGTCGCGCGAGCCCAACAAGGCGGCGGCGgctgctgctgctgctgctTCTATCCCGACATCAACGGGTGAGGTGGGTACTGTCGGTGCCGCGACGCACAAAGACTCAGGATACGGAAGCACCAGGCCAGACGGTGACGGCAGCGGAGATGTTGCCATGGATGAGGCGCCGCCAGTATCGCACCCGGCAGCACTCAGACCGGGAGTGGAGACGAACAAAGTTGTCGAAACGTCCAAGGGCCTCTGGACCGGCGTTGGAAGCCGGGGGTAA


Protein sequences

Name Description Sequence
Mgr.4475 translated coding region predicted by ESTScan from UniGene Mgr.4475

MATTQTTQGQIQPCRYKVGKTLGAGSYSVVKECVHIDTGRYYAAKVINKRLMAGREHMVRNEIAVLKKVSMGHQNILTLVDYFETMNNLYLVTDLALGGELFDRICRKGSYYESDAVDLIRATLSAVAYLHDHGIVHRDLKPENLLFRTPEDNADLLIADFGLSRIMDEEQFHVLTTTCGTPGYMAPEIFKKTGHGKPVDIWALGVITYFLLCGYTPFDRDSDLEEMQAILNADYSFTPIEFWRGVSDSAKDFIRRCLTIDPTKRMSAHEALQHPFVAGYLADKGANLLPTVKKNFNARRTLHAAIDTVRAINKLREGQGLNGQRLMAGVKSREPNKAAAAAAAAASIPTSTGEVGTVGAATHKDSGYGSTRPDGDGSGDVAMDEAPPVSHPAALRPGVETNKVVETSKGLWTGVGSRG

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24349:SF75
1-313 SUBFAMILY NOT NAMED

MATTQTTQGQIQPCRYKVGKTLGAGSYSVVKECVHIDTGRYYAAKVINKRLMAGREHMVRNEIAVLKKVSMGHQNILTLVDYFETMNNLYLVTDLALGGELFDRICRKGSYYESDAVDLIRATLSAVAYLHDHGIVHRDLKPENLLFRTPEDNADLLIADFGLSRIMDEEQFHVLTTTCGTPGYMAPEIFKKTGHGKPVDIWALGVITYFLLCGYTPFDRDSDLEEMQAILNADYSFTPIEFWRGVSDSAKDFIRRCLTIDPTKRMSAHEALQHPFVAGYLADKGANLLPTVKKNFNARRTLHAAIDTVRAIN

HMMPanther: PTHR24349
1-313 FAMILY NOT NAMED,SERINE/THREONINE-PROTEIN KINASE

MATTQTTQGQIQPCRYKVGKTLGAGSYSVVKECVHIDTGRYYAAKVINKRLMAGREHMVRNEIAVLKKVSMGHQNILTLVDYFETMNNLYLVTDLALGGELFDRICRKGSYYESDAVDLIRATLSAVAYLHDHGIVHRDLKPENLLFRTPEDNADLLIADFGLSRIMDEEQFHVLTTTCGTPGYMAPEIFKKTGHGKPVDIWALGVITYFLLCGYTPFDRDSDLEEMQAILNADYSFTPIEFWRGVSDSAKDFIRRCLTIDPTKRMSAHEALQHPFVAGYLADKGANLLPTVKKNFNARRTLHAAIDTVRAIN

superfamily: SSF56112
IPR011009
2-308 Protein kinase-like (PK-like)
Protein kinase-like domain

ATTQTTQGQIQPCRYKVGKTLGAGSYSVVKECVHIDTGRYYAAKVINKRLMAGREHMVRNEIAVLKKVSMGHQNILTLVDYFETMNNLYLVTDLALGGELFDRICRKGSYYESDAVDLIRATLSAVAYLHDHGIVHRDLKPENLLFRTPEDNADLLIADFGLSRIMDEEQFHVLTTTCGTPGYMAPEIFKKTGHGKPVDIWALGVITYFLLCGYTPFDRDSDLEEMQAILNADYSFTPIEFWRGVSDSAKDFIRRCLTIDPTKRMSAHEALQHPFVAGYLADKGANLLPTVKKNFNARRTLHAAIDT

Gene3D: G3DSA:3.30.200.20
5-112 no description

QTTQGQIQPCRYKVGKTLGAGSYSVVKECVHIDTGRYYAAKVINKRLMAGREHMVRNEIAVLKKVSMGHQNILTLVDYFETMNNLYLVTDLALGGELFDRICRKGSYY

ProfileScan: PS50011
IPR000719
16-277 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YKVGKTLGAGSYSVVKECVHIDTGRYYAAKVINKRLMAGREHMVRNEIAVLKKVSMGHQNILTLVDYFETMNNLYLVTDLALGGELFDRICRKGSYYESDAVDLIRATLSAVAYLHDHGIVHRDLKPENLLFRTPEDNADLLIADFGLSRIMDEEQFHVLTTTCGTPGYMAPEIFKKTGHGKPVDIWALGVITYFLLCGYTPFDRDSDLEEMQAILNADYSFTPIEFWRGVSDSAKDFIRRCLTIDPTKRMSAHEALQHPFV

HMMPfam: PF00069
IPR017442
16-277 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

YKVGKTLGAGSYSVVKECVHIDTGRYYAAKVINKRLMAGREHMVRNEIAVLKKVSMGHQNILTLVDYFETMNNLYLVTDLALGGELFDRICRKGSYYESDAVDLIRATLSAVAYLHDHGIVHRDLKPENLLFRTPEDNADLLIADFGLSRIMDEEQFHVLTTTCGTPGYMAPEIFKKTGHGKPVDIWALGVITYFLLCGYTPFDRDSDLEEMQAILNADYSFTPIEFWRGVSDSAKDFIRRCLTIDPTKRMSAHEALQHPFV

HMMSmart: SM00220
IPR002290
16-277 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YKVGKTLGAGSYSVVKECVHIDTGRYYAAKVINKRLMAGREHMVRNEIAVLKKVSMGHQNILTLVDYFETMNNLYLVTDLALGGELFDRICRKGSYYESDAVDLIRATLSAVAYLHDHGIVHRDLKPENLLFRTPEDNADLLIADFGLSRIMDEEQFHVLTTTCGTPGYMAPEIFKKTGHGKPVDIWALGVITYFLLCGYTPFDRDSDLEEMQAILNADYSFTPIEFWRGVSDSAKDFIRRCLTIDPTKRMSAHEALQHPFV

HMMSmart: SM00219
IPR020635
16-277 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

YKVGKTLGAGSYSVVKECVHIDTGRYYAAKVINKRLMAGREHMVRNEIAVLKKVSMGHQNILTLVDYFETMNNLYLVTDLALGGELFDRICRKGSYYESDAVDLIRATLSAVAYLHDHGIVHRDLKPENLLFRTPEDNADLLIADFGLSRIMDEEQFHVLTTTCGTPGYMAPEIFKKTGHGKPVDIWALGVITYFLLCGYTPFDRDSDLEEMQAILNADYSFTPIEFWRGVSDSAKDFIRRCLTIDPTKRMSAHEALQHPFV

PatternScan: PS00107
IPR017441
22-45 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGAGSYSVVKECVHIDTGRYYAAK

Gene3D: G3DSA:1.10.510.10
113-297 no description

ESDAVDLIRATLSAVAYLHDHGIVHRDLKPENLLFRTPEDNADLLIADFGLSRIMDEEQFHVLTTTCGTPGYMAPEIFKKTGHGKPVDIWALGVITYFLLCGYTPFDRDSDLEEMQAILNADYSFTPIEFWRGVSDSAKDFIRRCLTIDPTKRMSAHEALQHPFVAGYLADKGANLLPTVKKNFN

PatternScan: PS00108
IPR008271
135-147 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDLKPENLLF

Seg: seg
338-346 seg

AAAAAAAAA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox