PRGDB00071114 (Mgr.5146)

From PRG Wiki
Jump to: navigation, search
Mgr.5146
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145613491 (XM_363670)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Magnaporthe grisea

Comment?

Magnaporthe grisea 70-15 hypothetical protein (MGG_01596) partial mRNA

DNA Sequence

ATGCCCCGGCGACGTTTGAATCCATTCCAAATTCTAACAGCCTTCTTTCAGCCCTCTACTGCCGATTCGGACGGAGAATCTTTCAAGAAACCTCGCAGGACGGAACGTGCAGCTCACAAGGCGGAGGAATCCACCGCGCAGCCAAAAACCCCGGTGGACACCAAGCAGCAACTGCCGTCCCCCATCACGCATAACCCTACCGAGGGCAGCTTCGATGCCTACAAGGAAGGGACTGTAACACCGCCTGAGGGCCGCCCGAGCCAAGTCGCACATCGCTCGCCAGTCCAGGGCTTCTCGTCACCACCACAGGATACACAAGCAACACAAGCTATTCCCTCGCAGATCGTTGATCCGAAGGCCGCGCTATCCGACGAGGTCGAAGACGAGGTGAAGGAGGGCGTATGGGGCTATCTTTTCCCTCTCGATACCAGATACGGCGGCAAATGTGTCGTTTTGCGGAAGCGTGGTTCCTGTCCTATGCCTGACACGAACGGCAAAAGCGACGACAAGCCATGTGACAAAGCTTCTAAGGATATTGTGGTTGACGACCCCATCGTCTCAAATCGACACTGCCTCATATTTGCCGAGCACAAGGGCAACGACACTGTAGTCATTCTTGAGGATCTATCCAGTAACGGCACTTTTGTCAACGAGGCCATAGTCGGTCGCAACCAGCGGAGGGAGCTTTTGGAGCAAGACGAGATCGCTGTCAAGGATACAGCTCGTTTTATATTCCGGTATCCTAAATATCGTCAAACCAGCGCATTCTCGCAGCAGTACACACTGCTGGGCAAGCTTGGCAAAGGGCACTTCGCTGAAGTCTTTGCATGCGTTGAGAAATCCACAGGGCAGCGCTATGCGGTCAAAATATTCTCCATGGTCCCTGGTTTGGAAGAACGGTCCAGGACAGAAGGTCTCCAGCTGGAGATTGCTGTATTGATGGGCGTCAGTCATCCCAATGTGCTGTGCTTAAAGGATACCTTTCACGAGGGCAATGCAGTGTATCTGGTGCTTGAGCTGGCCCCGGAAGGTGAACTTTTCAACTTCATTGTTATGAAGCAAAAGCTTTCAGAGGCTGAGAGTCGGAAACTGTTCACCCAACTTTTCCACGGTGTCAAATACTTGCATGACCGAAACATTGTCCACCGCGATATCAAACCGGAGAACATCTTGCTGGTTGACAAGGATCTGCACGTCAAAATTGCCGATTTTGGGCTTGCCAAAATTATCGGCGAGGAGTCCTTCACGACGTCTCTGTGTGGCACGCCTAGCTACGTCGCACCCGAAATTCTCGTTGATGGCCGGCATCGCAAGTACACGAAAGCTGTTGACGTATGGTCGTTGGGCGTTGTGCTTTACATCTGCCTGTGCGGATTTCCGCCGTTCTCCGACGAGTTGACGAGCGAATCATTCCCTTATACCCTCACTCAGCAAATAAAAAACGGTATCTTTCACTACCCGTCGCCATACTGGGACTCGGTCGGTGATCCAGCTTTGAGCTTGATTGACTGTATGCTTGTCGTTGACCCAGAAAAGCGGTATACCATCGATCAATGCCTGGCTCACCCATGGATGACGCAAGCGCAACCCTCCGTTCACGACAGCACGGATGGCCTCGTTGGCGGCTTCGCTGGCCTTGAGGTGAACAGACGTGGTATTGTCCGGGAAAGGACACTCCTCTCTTCGATCAACTCTGTTCAAGTCACACGTGTACCTGCAGGCCCGAACCAAGAACCAGTCAAGGTATTCATCAAGAACCCCAAGGATGGCAAAGCAAACCGTGCACCAGAACCGGGCCCGTCTCAGAATCGACGGCCAGATGAGTTCATCGAGATGGGCGGTAAAGGGGATCAACCTTTGTTTGGCCATGACGGCGGGAGTAACTATCCTTCAGCCGATATCGCCTCTCAAAAGACTGCCATAAGTCAGCCTGCTCTCAATGGCGCAGAAACTTCTAAGGACGACGAAGTTAAAGAAATCAATGCGAATGGAAAGACCAAGCCCACGGCGGCAGGCAAGGGCAAGGAACACTGA


Protein sequences

Name Description Sequence
Mgr.5146 translated coding region predicted by ESTScan from UniGene Mgr.5146

MPRRRLNPFQILTAFFQPSTADSDGESFKKPRRTERAAHKAEESTAQPKTPVDTKQQLPSPITHNPTEGSFDAYKEGTVTPPEGRPSQVAHRSPVQGFSSPPQDTQATQAIPSQIVDPKAALSDEVEDEVKEGVWGYLFPLDTRYGGKCVVLRKRGSCPMPDTNGKSDDKPCDKASKDIVVDDPIVSNRHCLIFAEHKGNDTVVILEDLSSNGTFVNEAIVGRNQRRELLEQDEIAVKDTARFIFRYPKYRQTSAFSQQYTLLGKLGKGHFAEVFACVEKSTGQRYAVKIFSMVPGLEERSRTEGLQLEIAVLMGVSHPNVLCLKDTFHEGNAVYLVLELAPEGELFNFIVMKQKLSEAESRKLFTQLFHGVKYLHDRNIVHRDIKPENILLVDKDLHVKIADFGLAKIIGEESFTTSLCGTPSYVAPEILVDGRHRKYTKAVDVWSLGVVLYICLCGFPPFSDELTSESFPYTLTQQIKNGIFHYPSPYWDSVGDPALSLIDCMLVVDPEKRYTIDQCLAHPWMTQAQPSVHDSTDGLVGGFAGLEVNRRGIVRERTLLSSINSVQVTRVPAGPNQEPVKVFIKNPKDGKANRAPEPGPSQNRRPDEFIEMGGKGDQPLFGHDGGSNYPSADIASQKTAISQPALNGAETSKDDEVKEINANGKTKPTAAGKGKEH

Domains

Domain Start-End Description Sequence

superfamily: SSF49879
IPR008984
103-270 SMAD/FHA domain
SMAD/FHA domain

QDTQATQAIPSQIVDPKAALSDEVEDEVKEGVWGYLFPLDTRYGGKCVVLRKRGSCPMPDTNGKSDDKPCDKASKDIVVDDPIVSNRHCLIFAEHKGNDTVVILEDLSSNGTFVNEAIVGRNQRRELLEQDEIAVKDTARFIFRYPKYRQTSAFSQQYTLLGKLGKGH

HMMSmart: SM00240
IPR000253
161-221 Forkhead associated domain
Forkhead-associated (FHA) domain

PDTNGKSDDKPCDKASKDIVVDDPIVSNRHCLIFAEHKGNDTVVILEDLSSNGTFVNEAIV

ProfileScan: PS50006
IPR000253
162-221 FHA_DOMAIN
Forkhead-associated (FHA) domain

DTNGKSDDKPCDKASKDIVVDDPIVSNRHCLIFAEHKGNDTVVILEDLSSNGTFVNEAIV

HMMPfam: PF00498
IPR000253
175-236 FHA
Forkhead-associated (FHA) domain

ASKDIVVDDPIVSNRHCLIFAEHKGNDTVVILEDLSSNGTFVNEAIVGRNQRRELLEQDEIA

Gene3D: G3DSA:2.60.200.20
IPR000253
176-251 no description
Forkhead-associated (FHA) domain

SKDIVVDDPIVSNRHCLIFAEHKGNDTVVILEDLSSNGTFVNEAIVGRNQRRELLEQDEIAVKDTARFIFRYPKYR

HMMPanther: PTHR24344
185-567 FAMILY NOT NAMED,SERINE/THREONINE-PROTEIN KINASE CDS1

IVSNRHCLIFAEHKGNDTVVILEDLSSNGTFVNEAIVGRNQRRELLEQDEIAVKDTARFIFRYPKYRQTSAFSQQYTLLGKLGKGHFAEVFACVEKSTGQRYAVKIFSMVPGLEERSRTEGLQLEIAVLMGVSHPNVLCLKDTFHEGNAVYLVLELAPEGELFNFIVMKQKLSEAESRKLFTQLFHGVKYLHDRNIVHRDIKPENILLVDKDLHVKIADFGLAKIIGEESFTTSLCGTPSYVAPEILVDGRHRKYTKAVDVWSLGVVLYICLCGFPPFSDELTSESFPYTLTQQIKNGIFHYPSPYWDSVGDPALSLIDCMLVVDPEKRYTIDQCLAHPWMTQAQPSVHDSTDGLVGGFAGLEVNRRGIVRERTLLSSINSVQ

HMMPanther: PTHR24344:SF26
185-567 SUBFAMILY NOT NAMED

IVSNRHCLIFAEHKGNDTVVILEDLSSNGTFVNEAIVGRNQRRELLEQDEIAVKDTARFIFRYPKYRQTSAFSQQYTLLGKLGKGHFAEVFACVEKSTGQRYAVKIFSMVPGLEERSRTEGLQLEIAVLMGVSHPNVLCLKDTFHEGNAVYLVLELAPEGELFNFIVMKQKLSEAESRKLFTQLFHGVKYLHDRNIVHRDIKPENILLVDKDLHVKIADFGLAKIIGEESFTTSLCGTPSYVAPEILVDGRHRKYTKAVDVWSLGVVLYICLCGFPPFSDELTSESFPYTLTQQIKNGIFHYPSPYWDSVGDPALSLIDCMLVVDPEKRYTIDQCLAHPWMTQAQPSVHDSTDGLVGGFAGLEVNRRGIVRERTLLSSINSVQ

superfamily: SSF56112
IPR011009
242-585 Protein kinase-like (PK-like)
Protein kinase-like domain

RFIFRYPKYRQTSAFSQQYTLLGKLGKGHFAEVFACVEKSTGQRYAVKIFSMVPGLEERSRTEGLQLEIAVLMGVSHPNVLCLKDTFHEGNAVYLVLELAPEGELFNFIVMKQKLSEAESRKLFTQLFHGVKYLHDRNIVHRDIKPENILLVDKDLHVKIADFGLAKIIGEESFTTSLCGTPSYVAPEILVDGRHRKYTKAVDVWSLGVVLYICLCGFPPFSDELTSESFPYTLTQQIKNGIFHYPSPYWDSVGDPALSLIDCMLVVDPEKRYTIDQCLAHPWMTQAQPSVHDSTDGLVGGFAGLEVNRRGIVRERTLLSSINSVQVTRVPAGPNQEPVKVFIK

Gene3D: G3DSA:3.30.200.20
252-358 no description

QTSAFSQQYTLLGKLGKGHFAEVFACVEKSTGQRYAVKIFSMVPGLEERSRTEGLQLEIAVLMGVSHPNVLCLKDTFHEGNAVYLVLELAPEGELFNFIVMKQKLSE

HMMPfam: PF00069
IPR017442
260-525 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

YTLLGKLGKGHFAEVFACVEKSTGQRYAVKIFSMVPGLEERSRTEGLQLEIAVLMGVSHPNVLCLKDTFHEGNAVYLVLELAPEGELFNFIVMKQKLSEAESRKLFTQLFHGVKYLHDRNIVHRDIKPENILLVDKDLHVKIADFGLAKIIGEESFTTSLCGTPSYVAPEILVDGRHRKYTKAVDVWSLGVVLYICLCGFPPFSDELTSESFPYTLTQQIKNGIFHYPSPYWDSVGDPALSLIDCMLVVDPEKRYTIDQCLAHPWM

ProfileScan: PS50011
IPR000719
260-525 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YTLLGKLGKGHFAEVFACVEKSTGQRYAVKIFSMVPGLEERSRTEGLQLEIAVLMGVSHPNVLCLKDTFHEGNAVYLVLELAPEGELFNFIVMKQKLSEAESRKLFTQLFHGVKYLHDRNIVHRDIKPENILLVDKDLHVKIADFGLAKIIGEESFTTSLCGTPSYVAPEILVDGRHRKYTKAVDVWSLGVVLYICLCGFPPFSDELTSESFPYTLTQQIKNGIFHYPSPYWDSVGDPALSLIDCMLVVDPEKRYTIDQCLAHPWM

HMMSmart: SM00219
IPR020635
260-525 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

YTLLGKLGKGHFAEVFACVEKSTGQRYAVKIFSMVPGLEERSRTEGLQLEIAVLMGVSHPNVLCLKDTFHEGNAVYLVLELAPEGELFNFIVMKQKLSEAESRKLFTQLFHGVKYLHDRNIVHRDIKPENILLVDKDLHVKIADFGLAKIIGEESFTTSLCGTPSYVAPEILVDGRHRKYTKAVDVWSLGVVLYICLCGFPPFSDELTSESFPYTLTQQIKNGIFHYPSPYWDSVGDPALSLIDCMLVVDPEKRYTIDQCLAHPWM

HMMSmart: SM00220
IPR002290
260-525 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YTLLGKLGKGHFAEVFACVEKSTGQRYAVKIFSMVPGLEERSRTEGLQLEIAVLMGVSHPNVLCLKDTFHEGNAVYLVLELAPEGELFNFIVMKQKLSEAESRKLFTQLFHGVKYLHDRNIVHRDIKPENILLVDKDLHVKIADFGLAKIIGEESFTTSLCGTPSYVAPEILVDGRHRKYTKAVDVWSLGVVLYICLCGFPPFSDELTSESFPYTLTQQIKNGIFHYPSPYWDSVGDPALSLIDCMLVVDPEKRYTIDQCLAHPWM

PatternScan: PS00107
IPR017441
266-289 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGKGHFAEVFACVEKSTGQRYAVK

Gene3D: G3DSA:1.10.510.10
359-530 no description

AESRKLFTQLFHGVKYLHDRNIVHRDIKPENILLVDKDLHVKIADFGLAKIIGEESFTTSLCGTPSYVAPEILVDGRHRKYTKAVDVWSLGVVLYICLCGFPPFSDELTSESFPYTLTQQIKNGIFHYPSPYWDSVGDPALSLIDCMLVVDPEKRYTIDQCLAHPWMTQAQP

PatternScan: PS00108
IPR008271
380-392 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDIKPENILL

Seg: seg
664-675 seg

GKTKPTAAGKGK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox