PRGDB00071115 (Mgr.6074)

From PRG Wiki
Jump to: navigation, search
Mgr.6074
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 39968864 (XM_365823)
Gene Class Unknown
Domain Type
Gene Species Magnaporthe grisea

Comment?

Magnaporthe grisea 70-15 hypothetical protein (MGG_02525) partial mRNA

DNA Sequence

ATGTCTTCTCAACCTGAGCATCCCACCCTGCTCATTCCCGGCCCTATCGAGTTTGACGATGCTGTCCTCCAGTCCATGAGCCATTACAGCGAGAGCCACGTTGGTCCGGCTTTTGTCAACGTTTTTGGCGAGACCTTGACCCTCCTTCGCAAACTGTTCCAGACTACGGATTCGGGCTCGCAGCCATTTGTCATCTCAGGGTCCGGCACCCTTGGATGGGATCTGGTCTCTGCCAACCTTGTCGAAGCCGGCGAGGATGTGCTGGTTCTTGGCACTGGCTACTTCAGTGACGGTTTCGCCGACTGCCTGCGAACCTATGGCGCCAACGTAACGGAGCTCAAGGCCCCCGTTGGATCCAGGCCTCAACTGCCCGAGATTGAGAAGGCTCTTAGTGCCAAGAAGTACAAAGTCCTCACCGTCACGCACGTTGACACCTCAACCGGCGTGCTCAGCGAGCTGAAGGACCTCAGCGCCATGGTGCACAAGGTCTCCCCTGAGACCCTCATCATCGCCGATGGTGTATGCAGTGTGGCTTCTGAGGAGATTGCGTTTGATGAGTGGGGTCTGGACGGTGTGATCACTGCCAGCCAAAAGGCTATCGGATGCCCGGCTGGTCTCTCGATCTCAATGTTCAGCTCAAGGGCAATCAAGGCATTTGAGGCTAGGAAAACCCCTCCCGCCTCCTACTTTGCATCCATGAAGAACTGGCTGCCAATCATGCGCAACTACGAGGCCAAGAAGCCTTCATACTTTGCTACCCCGTCGCCTCAGCTCATCCACGCCCTCCACACGGCCCTGACCCAGATAATGTCAAGGCCACTTGCTGAGCGCTTCGCTAAGCACAAGGAGGCCTCAAGCAAGATCAAGAAGGCTATCGCCGATCTTGGCCTCAAGCAGGTTGCCTCGAACCCTGCCGACCAGGCTAATGGCATGACGGCAGTCTACCTCCCTGAGAGCGTGAAGCCGACCGATATCTTGCCGAAGCTGTTCAGCAAAGGAGTTATCTTTGCCGGTGGTATTCACAAGGAGATTGCCCCCAAGTATATCAGATTCGGCCACATGGGCGTCAGCGTGTTGAACCCGGAAAGGGGTGATCTTGATCGTGCCATCAAGGCTCTCGAGTCTGGACTGTCGGAGTGCGGTTATCAAAAAGCATAG


Protein sequences

Name Description Sequence
Mgr.6074 translated coding region predicted by ESTScan from UniGene Mgr.6074

MSSQPEHPTLLIPGPIEFDDAVLQSMSHYSESHVGPAFVNVFGETLTLLRKLFQTTDSGSQPFVISGSGTLGWDLVSANLVEAGEDVLVLGTGYFSDGFADCLRTYGANVTELKAPVGSRPQLPEIEKALSAKKYKVLTVTHVDTSTGVLSELKDLSAMVHKVSPETLIIADGVCSVASEEIAFDEWGLDGVITASQKAIGCPAGLSISMFSSRAIKAFEARKTPPASYFASMKNWLPIMRNYEAKKPSYFATPSPQLIHALHTALTQIMSRPLAERFAKHKEASSKIKKAIADLGLKQVASNPADQANGMTAVYLPESVKPTDILPKLFSKGVIFAGGIHKEIAPKYIRFGHMGVSVLNPERGDLDRAIKALESGLSECGYQKA

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR21152
1-383 FAMILY NOT NAMED,AMINOTRANSFERASE CLASS V

MSSQPEHPTLLIPGPIEFDDAVLQSMSHYSESHVGPAFVNVFGETLTLLRKLFQTTDSGSQPFVISGSGTLGWDLVSANLVEAGEDVLVLGTGYFSDGFADCLRTYGANVTELKAPVGSRPQLPEIEKALSAKKYKVLTVTHVDTSTGVLSELKDLSAMVHKVSPETLIIADGVCSVASEEIAFDEWGLDGVITASQKAIGCPAGLSISMFSSRAIKAFEARKTPPASYFASMKNWLPIMRNYEAKKPSYFATPSPQLIHALHTALTQIMSRPLAERFAKHKEASSKIKKAIADLGLKQVASNPADQANGMTAVYLPESVKPTDILPKLFSKGVIFAGGIHKEIAPKYIRFGHMGVSVLNPERGDLDRAIKALESGLSECGYQ

HMMPanther: PTHR21152:SF7
1-383 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

MSSQPEHPTLLIPGPIEFDDAVLQSMSHYSESHVGPAFVNVFGETLTLLRKLFQTTDSGSQPFVISGSGTLGWDLVSANLVEAGEDVLVLGTGYFSDGFADCLRTYGANVTELKAPVGSRPQLPEIEKALSAKKYKVLTVTHVDTSTGVLSELKDLSAMVHKVSPETLIIADGVCSVASEEIAFDEWGLDGVITASQKAIGCPAGLSISMFSSRAIKAFEARKTPPASYFASMKNWLPIMRNYEAKKPSYFATPSPQLIHALHTALTQIMSRPLAERFAKHKEASSKIKKAIADLGLKQVASNPADQANGMTAVYLPESVKPTDILPKLFSKGVIFAGGIHKEIAPKYIRFGHMGVSVLNPERGDLDRAIKALESGLSECGYQ

superfamily: SSF53383
IPR015424
5-384 PLP-dependent transferases
Pyridoxal phosphate-dependent transferase, major d

PEHPTLLIPGPIEFDDAVLQSMSHYSESHVGPAFVNVFGETLTLLRKLFQTTDSGSQPFVISGSGTLGWDLVSANLVEAGEDVLVLGTGYFSDGFADCLRTYGANVTELKAPVGSRPQLPEIEKALSAKKYKVLTVTHVDTSTGVLSELKDLSAMVHKVSPETLIIADGVCSVASEEIAFDEWGLDGVITASQKAIGCPAGLSISMFSSRAIKAFEARKTPPASYFASMKNWLPIMRNYEAKKPSYFATPSPQLIHALHTALTQIMSRPLAERFAKHKEASSKIKKAIADLGLKQVASNPADQANGMTAVYLPESVKPTDILPKLFSKGVIFAGGIHKEIAPKYIRFGHMGVSVLNPERGDLDRAIKALESGLSECGYQK

HMMPfam: PF00266
IPR000192
18-341 Aminotran_5
Aminotransferase, class V/Cysteine desulfurase

FDDAVLQSMSHYSESHVGPAFVNVFGETLTLLRKLFQTTDSGSQPFVISGSGTLGWDLVSANLVEAGEDVLVLGTGYFSDGFADCLRTYGANVTELKAPVGSRPQLPEIEKALSAKKYKVLTVTHVDTSTGVLSELKDLSAMVHKVSPETLIIADGVCSVASEEIAFDEWGLDGVITASQKAIGCPAGLSISMFSSRAIKAFEARKTPPASYFASMKNWLPIMRNYEAKKPSYFATPSPQLIHALHTALTQIMSRPLAERFAKHKEASSKIKKAIADLGLKQVASNPADQANGMTAVYLPESVKPTDILPKLFSKGVIFAGGIH

Gene3D: G3DSA:3.40.640.10
IPR015421
20-259 no description
Pyridoxal phosphate-dependent transferase, major r

DAVLQSMSHYSESHVGPAFVNVFGETLTLLRKLFQTTDSGSQPFVISGSGTLGWDLVSANLVEAGEDVLVLGTGYFSDGFADCLRTYGANVTELKAPVGSRPQLPEIEKALSAKKYKVLTVTHVDTSTGVLSELKDLSAMVHKVSPETLIIADGVCSVASEEIAFDEWGLDGVITASQKAIGCPAGLSISMFSSRAIKAFEARKTPPASYFASMKNWLPIMRNYEAKKPSYFATPSPQLI

Gene3D: G3DSA:3.90.1150.10
IPR015422
260-383 no description
Pyridoxal phosphate-dependent transferase, major r

HALHTALTQIMSRPLAERFAKHKEASSKIKKAIADLGLKQVASNPADQANGMTAVYLPESVKPTDILPKLFSKGVIFAGGIHKEIAPKYIRFGHMGVSVLNPERGDLDRAIKALESGLSECGYQ

Seg: seg
279-293 seg

AKHKEASSKIKKAIA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox