PRGDB00071116 (Mgr.6639)

From PRG Wiki
Jump to: navigation, search
Mgr.6639
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 39971246 (XM_367014)
Gene Class Unknown
Domain Type
Gene Species Magnaporthe grisea

Comment?

Magnaporthe grisea 70-15 hypothetical protein (MGG_03090) partial mRNA

DNA Sequence

ATGCCGCCTGACCGAAAGCAGAAGAGGGAGTCGGCTCCTGCCAGGCCCCCGTACTCACAGCTGCGGCGCACGATCAAGAAGGAAGATGTGGCCATGTCTGGTTTCACGAGGTGGTGCGTCAAGCACCAAATTGGGCTATCCATGAACCTTCTCGCGCTCCTAGCCCTCACTCATGTCTGTTTCCCCAAGAGCCACAAATATACAACCAAGTTCTTTTCTCAGTCCTACTACAACCCCAGGAGTGGCGAATACGGTATTGGCAAGGATGATTACTACCAGATCTTCTTCTATATGACGATATTTACAGCCCTCAGGGCTGGTACCATGGACTATGTTCTCGCGCCGCTTGCAAGATGGTGGGGTATCACCAAAAGGAAAACCATCGACCGCTTCAGTGAGCAGGGCTATCTTGTGTTATACTATGCTATTTTCTGGCCCATGGGAATGTACATCTACTGCAACTCTGATTACTACATGAACTTGACAAACTTGTGGACGAACTGGCCCAACAGGGAAGTTAGTGGGCTGATGCGCGTCTACATGCTCGCGCAACTTGCCTTTTGGTTCCAACAAATCCTCGTCATCAATATCGAGGAACGTAGGAAAGACCACTGGCAGATGTTTGCGCACCACGTGGTTACCATCGTCCTCATTACGACGTCATGGCGCTACGGCTACACGCGTGTCGGCAACCTGATCCTCATTTTGATGGATGGAGTTGACATTGTGTTCTCTGCTGCCAAACTCTTGAAATACACGGGCTTCGATACTGCCTGTGATGTCTTTTTCGGTCTTTTCATGCTCAGCTGGGTTATCGCGCGTCACTTCGTGTACCTCACGGTTTGCTGGTCGATATATAAGGAGGCGCCGAGCGTCATGCCTGATGGCTGCTTCCGCGGTCCGGCCGACAAGATCGAGGGGCCTTTCCCAGTGCCTTCAGACAGGGGCCTGTGGTATATCGTAGAGCCACTCATCAACAACAATTCACTGGTGTGCTTCGACGACCCGGTGAAATGGTCATTCCTCTTGTCTCTCCTCTTCCTCCAGGGCATTTTGCTTGTGTGGCTCGTGGCCATCTTCCGCGTCGCCATCAAGGTCCTCCGCGGGACGGGCGCCGAAGACACGCGCAGCGACGACGAAGAAGACGAGGAGGAAGATATTGAAGCCGATGGCGTGACCTACCAAAAGACGGGTGCCACGCTCAAGGATGCTGTCGCTGGTCGCGGTGGCAAGACGACGCTGTCTGACGATGACAATGACGAGCCGATCGAGGAGGAGGTCGGTGTGGAGGACATTGACTTTAAGGGTTGGGGCAGGCGATCGGGCGTCAAGAGGCAGGCCTCATCCGCGACCGGTGTTAGTCTTCCCGGCCACAGCGACCGGAAGGAGCTTCTCGGCAGGATTGGTTGCGAGAAACAGGTCGACTGA


Protein sequences

Name Description Sequence
Mgr.6639 translated coding region predicted by ESTScan from UniGene Mgr.6639

MPPDRKQKRESAPARPPYSQLRRTIKKEDVAMSGFTRWCVKHQIGLSMNLLALLALTHVCFPKSHKYTTKFFSQSYYNPRSGEYGIGKDDYYQIFFYMTIFTALRAGTMDYVLAPLARWWGITKRKTIDRFSEQGYLVLYYAIFWPMGMYIYCNSDYYMNLTNLWTNWPNREVSGLMRVYMLAQLAFWFQQILVINIEERRKDHWQMFAHHVVTIVLITTSWRYGYTRVGNLILILMDGVDIVFSAAKLLKYTGFDTACDVFFGLFMLSWVIARHFVYLTVCWSIYKEAPSVMPDGCFRGPADKIEGPFPVPSDRGLWYIVEPLINNNSLVCFDDPVKWSFLLSLLFLQGILLVWLVAIFRVAIKVLRGTGAEDTRSDDEEDEEEDIEADGVTYQKTGATLKDAVAGRGGKTTLSDDDNDEPIEEEVGVEDIDFKGWGRRSGVKRQASSATGVSLPGHSDRKELLGRIGCEKQVD


Domains

Domain Start-End Description Sequence

HMMPIR: PIRSF005225
IPR016439
2-405 LAG1_LAC1
Longevity assurance, LAG1/LAC1

PPDRKQKRESAPARPPYSQLRRTIKKEDVAMSGFTRWCVKHQIGLSMNLLALLALTHVCFPKSHKYTTKFFSQSYYNPRSGEYGIGKDDYYQIFFYMTIFTALRAGTMDYVLAPLARWWGITKRKTIDRFSEQGYLVLYYAIFWPMGMYIYCNSDYYMNLTNLWTNWPNREVSGLMRVYMLAQLAFWFQQILVINIEERRKDHWQMFAHHVVTIVLITTSWRYGYTRVGNLILILMDGVDIVFSAAKLLKYTGFDTACDVFFGLFMLSWVIARHFVYLTVCWSIYKEAPSVMPDGCFRGPADKIEGPFPVPSDRGLWYIVEPLINNNSLVCFDDPVKWSFLLSLLFLQGILLVWLVAIFRVAIKVLRGTGAEDTRSDDEEDEEEDIEADGVTYQKTGATLKDAV

HMMPfam: PF08390
IPR013599
67-126 TRAM1
TRAM1-like protein

YTTKFFSQSYYNPRSGEYGIGKDDYYQIFFYMTIFTALRAGTMDYVLAPLARWWGITKRK

HMMPanther: PTHR12560
95-388 PTHR12560,LONGEVITY ASSURANCE FACTOR 1 (LAG1)

FFYMTIFTALRAGTMDYVLAPLARWWGITKRKTIDRFSEQGYLVLYYAIFWPMGMYIYCNSDYYMNLTNLWTNWPNREVSGLMRVYMLAQLAFWFQQILVINIEERRKDHWQMFAHHVVTIVLITTSWRYGYTRVGNLILILMDGVDIVFSAAKLLKYTGFDTACDVFFGLFMLSWVIARHFVYLTVCWSIYKEAPSVMPDGCFRGPADKIEGPFPVPSDRGLWYIVEPLINNNSLVCFDDPVKWSFLLSLLFLQGILLVWLVAIFRVAIKVLRGTGAEDTRSDDEEDEEEDIE

ProfileScan: PS50922
IPR006634
129-368 TLC
TRAM/LAG1/CLN8 homology domain

DRFSEQGYLVLYYAIFWPMGMYIYCNSDYYMNLTNLWTNWPNREVSGLMRVYMLAQLAFWFQQILVINIEERRKDHWQMFAHHVVTIVLITTSWRYGYTRVGNLILILMDGVDIVFSAAKLLKYTGFDTACDVFFGLFMLSWVIARHFVYLTVCWSIYKEAPSVMPDGCFRGPADKIEGPFPVPSDRGLWYIVEPLINNNSLVCFDDPVKWSFLLSLLFLQGILLVWLVAIFRVAIKVLR

HMMSmart: SM00724
IPR006634
129-368 TLC
TRAM/LAG1/CLN8 homology domain

DRFSEQGYLVLYYAIFWPMGMYIYCNSDYYMNLTNLWTNWPNREVSGLMRVYMLAQLAFWFQQILVINIEERRKDHWQMFAHHVVTIVLITTSWRYGYTRVGNLILILMDGVDIVFSAAKLLKYTGFDTACDVFFGLFMLSWVIARHFVYLTVCWSIYKEAPSVMPDGCFRGPADKIEGPFPVPSDRGLWYIVEPLINNNSLVCFDDPVKWSFLLSLLFLQGILLVWLVAIFRVAIKVLR

HMMPfam: PF03798
IPR006634
130-361 TRAM_LAG1_CLN8
TRAM/LAG1/CLN8 homology domain

RFSEQGYLVLYYAIFWPMGMYIYCNSDYYMNLTNLWTNWPNREVSGLMRVYMLAQLAFWFQQILVINIEERRKDHWQMFAHHVVTIVLITTSWRYGYTRVGNLILILMDGVDIVFSAAKLLKYTGFDTACDVFFGLFMLSWVIARHFVYLTVCWSIYKEAPSVMPDGCFRGPADKIEGPFPVPSDRGLWYIVEPLINNNSLVCFDDPVKWSFLLSLLFLQGILLVWLVAIFR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox