PRGDB00071117 (Mgr.9653)

From PRG Wiki
Jump to: navigation, search
Mgr.9653
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 30403765 (BM871442)
Gene Class Unknown
Domain Type
Gene Species Magnaporthe grisea

Comment?

mgns014xK12f.b Magnaporthe grisea NS Uni-Zap XR Library Magnaporthe grisea cDNA clone mgns014xK12 5', mRNA sequence

DNA Sequence

GGCGGCGGTTGAGATTATAGCAGCAATCATGGCTACCAAGAAAGAAGAAACCTTCTATGAGCTCTACCGCCGTACTAGTCTGGGCATATGTCTCACAGATGCTCTGGACGATCTCATCACGAACGATCGTATCAACCCTCAACTCGCCATGAAGATTCTGGCGAATTTTGATCGTGTTGTGGCTGAGACTTTGCAAGAGAAAGTCAAAGCCAGACTTCAGTTCAAGGGAGCTCTCGACAACTACCGCTTTTGCGACGACGTATGGACCTTTGTGATCAAGAACATTAACTTTAAGCTGGATGGTGGCAATCAGACCATCCAAGCCGACAAAGTCAAGATTGTTAGCTGCAATGCCAAACGTCCTGTAACAGATGCTTAGGACACACCTGTTCCGCATGTCAAATCGCCACGTACACGAGAGTCGAGAGCGAACAGGGGATCGCAGTCGAAGAGTAGCGCAAAGGTCAAGAAGGAGGAGCCTGAGTTCAAGACTGAACGTAACCCTTATTCTGCAGCGCCCAACCTGTATGCCAATGCCTACTTGAAGCGTGAGGATTCGCCCGATGTCAAAGACGAGGATGACGGCTAGTGGCGAGTGAATGACCATGTCCCCCATGA


Protein sequences

Name Description Sequence
Mgr.9653 translated coding region predicted by ESTScan from UniGene Mgr.9653

XAAVEIIAAIMATKKEETFYELYRRTSLGICLTDALDDLITNDRINPQLAMKILANFDRVVAETLQEKVKARLQFKGALDNYRFCDDVWTFVIKNINFKLDGGNQTIQADKVKIVSCNAKRPVTDAXDTPVPHVKSPRTRESRANRGSQSKSSAKVKKEEPEFKTERNPYSAAPNLYANAYLKREDSPDVKDEDDGXWRVNDHVPHX

Domains

Domain Start-End Description Sequence

Seg: seg
1-12 seg

XAAVEIIAAIMA

Gene3D: G3DSA:1.10.287.190
IPR015872
17-70 no description
Transcription initiation factor IIA, gamma subunit

ETFYELYRRTSLGICLTDALDDLITNDRINPQLAMKILANFDRVVAETLQEKVK

HMMPfam: PF02268
IPR015872
19-66 TFIIA_gamma_N
Transcription initiation factor IIA, gamma subunit

FYELYRRTSLGICLTDALDDLITNDRINPQLAMKILANFDRVVAETLQ

BlastProDom: PD009224
IPR015872
19-65 Q4WZV0_ASPFU_Q4WZV0;
Transcription initiation factor IIA, gamma subunit

FYELYRRTSLGICLTDALDDLITNDRINPQLAMKILANFDRVVAETL

HMMPanther: PTHR10966
IPR003194
20-128 TRANSCRIPTION INITIATION FACTOR IIA SUBUNIT 2
Transcription initiation factor IIA, gamma subunit

YELYRRTSLGICLTDALDDLITNDRINPQLAMKILANFDRVVAETLQEKVKARLQFKGALDNYRFCDDVWTFVIKNINFKLDGGNQTIQADKVKIVSCNAKRPVTDAXD

superfamily: SSF47396
IPR009083
20-70 Transcription factor IIA (TFIIA), alpha-helical domain
Transcription factor IIA, helical

YELYRRTSLGICLTDALDDLITNDRINPQLAMKILANFDRVVAETLQEKVK

superfamily: SSF50784
IPR009088
68-120 Transcription factor IIA (TFIIA), beta-barrel domain
Transcription factor IIA, beta-barrel

KVKARLQFKGALDNYRFCDDVWTFVIKNINFKLDGGNQTIQADKVKIVSCNAK

HMMPfam: PF02751
IPR015871
68-119 TFIIA_gamma_C
Transcription initiation factor IIA, gamma subunit

KVKARLQFKGALDNYRFCDDVWTFVIKNINFKLDGGNQTIQADKVKIVSCNA

Gene3D: G3DSA:2.30.18.10
IPR009088
72-122 no description
Transcription factor IIA, beta-barrel

RLQFKGALDNYRFCDDVWTFVIKNINFKLDGGNQTIQADKVKIVSCNAKRP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox