PRGDB00071118 (Mgr.10145)

From PRG Wiki
Jump to: navigation, search
Mgr.10145
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145608477 (XM_370084)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Magnaporthe grisea

Comment?

Magnaporthe grisea 70-15 conserved hypothetical protein (MGG_06599) partial mRNA

DNA Sequence

ATGACAAGAGTGGAGATTCTGGAATCTCGGGAGCGGCGACGCCGACAAATGAGAGCAACGTCGCCCTCAAAACCAGGCATCCTCGTGGTTACTATACACGAGGGCCAAGGCTTTTCTCTACCGGAGCAGCATCGGGCAGCGTTTGGCATGGGTAACCAACATTCGTCGTCGGTCTCGACGGGCAACGGCTTCGGCGTCGCCGGCTCGGTCCGACCCGGCTCGTCACAAAAAAGTCCTGGCGTCTTTAACGGAAGGCCACAGACGTCAGGCGGCGGGTTTGGAACGCTGCCGACGAACCACGGTCGATTCTCGGGCAAGTACATGCCCTATGCTCTGATCGACTTTGATAAGGTTCAAGTCTTTGTCAACTCGGTGGAAGGCTCCCCCGACAACCCCCTGTGGGCAGGTTCCAACACGCAGTACAAGTTCGACGTCTCGCGAGTCACGGAGCTCACGATCCACCTCTACATAAGAAACCCCAACGCACCACCCGGGTCAGGACGCAGCCAGGATATCTTCCTGGGCGTCTGCCGGATTCAGCCGCGATTTGAGGAGAGGCAGCCGTTCGTCGAGGATCCCAAGATGAGCAAGAAGGACAAGGAGAAGGCCCAGGCCGAGTGGGCCAAGCGGGAGCGGGCGCTTGGTTTCAGCGGCGTCGAGTGGGCCGACGTTCAGTACGGCACGGGCCGCCTCAAGATTGGTGTTGAGTTTGTCGCCAATAGGACTGGCAAGCTCAAGCTCGACGAGGACTTTGAGCTCCTCAAGGTGGTCGGCAAGGGCAGCTTCGGCAAGGTCATGCAGGTGCGCAAGAAGGACACGAACCGAATCTACGCCCTCAAGACGATCCGGAAAGCACACATCATCTCGCGTTCCGAGGTCACCCACACCCTGGCCGAGCGCTCCGTCCTGGCCCAGATCAACAACCCCTTCATCGTGCCCCTCAAGTTCGCCTTCCAGTCCCCCGAGAAGCTCTACTTCGTCTTGGCGTTCGTCAACGGTGGTGAGCTGTTCCACCACCTGCAGAAGGAGCAGCGGTTCGACGTCAACCGCTCGCGCTTCTACACGGCCGAGCTCATCTGCGCCCTCGAGTGTCTGCACGGCTTCAACGTCGTCTACCGCGACCTGAAGCCCGAGAACATCCTGCTCGACTACCAAGGCCACATTGCCCTCTGCGACTTTGGCCTGTGCAAGCTAGACATGAAGGACGAGGACCACACCAACACCTTTTGCGGAACTCCCGAGTACCTGGCACCCGAGCTGCTCGAGGGCAAGGGCTACGACAAGGCCGTCGACTGGTGGACCCTGGGCGTGCTGCTTTATGAGATGTTGACAGGCCTGCCACCTTTCTACGACGAGAACACCAACGAGATGTACAAGAAGATCCTGTACCAGCCTCTCGACTTCCCGGGCCCCGAGGTCGTACCGCCTGCCGCCCAGGACTTGCTGAGGAAGCTTTTGGACCGCGACCCCAAGACCCGTCTCGGATCGCCGGAGCGCGGACGTGGCGCTGCTGAGATCAAGTCCCACCCCTTCTTCCACGCCATAGATTGGCGCAAGTTGTTGCAGCGCAAGTATGAGCCGGCGTTCAAGCCCAGCGTGGCCAATGCTCTCGACACGACCAACTTTGACCCCGAGTTCACATCCGAGGCACCGCAGGACTCTTATGTCGAAGGACCGGTCCTCTCACAGACAATGCAGGACCAGTTCCAGGGCTTCAGCTATAACCGACCGATTGCGGGACTTGATGACGCCGGCGGTAGTGTTAAGGACCCTTCGTTTGTCGGCAGCCTTCAGGGAGGAAGATAG


Protein sequences

Name Description Sequence
Mgr.10145 translated coding region predicted by ESTScan from UniGene Mgr.10145

MTRVEILESRERRRRQMRATSPSKPGILVVTIHEGQGFSLPEQHRAAFGMGNQHSSSVSTGNGFGVAGSVRPGSSQKSPGVFNGRPQTSGGGFGTLPTNHGRFSGKYMPYALIDFDKVQVFVNSVEGSPDNPLWAGSNTQYKFDVSRVTELTIHLYIRNPNAPPGSGRSQDIFLGVCRIQPRFEERQPFVEDPKMSKKDKEKAQAEWAKRERALGFSGVEWADVQYGTGRLKIGVEFVANRTGKLKLDEDFELLKVVGKGSFGKVMQVRKKDTNRIYALKTIRKAHIISRSEVTHTLAERSVLAQINNPFIVPLKFAFQSPEKLYFVLAFVNGGELFHHLQKEQRFDVNRSRFYTAELICALECLHGFNVVYRDLKPENILLDYQGHIALCDFGLCKLDMKDEDHTNTFCGTPEYLAPELLEGKGYDKAVDWWTLGVLLYEMLTGLPPFYDENTNEMYKKILYQPLDFPGPEVVPPAAQDLLRKLLDRDPKTRLGSPERGRGAAEIKSHPFFHAIDWRKLLQRKYEPAFKPSVANALDTTNFDPEFTSEAPQDSYVEGPVLSQTMQDQFQGFSYNRPIAGLDDAGGSVKDPSFVGSLQGGR

Domains

Domain Start-End Description Sequence

Seg: seg
3-18 seg

RVEILESRERRRRQMR

HMMPanther: PTHR24354:SF102
8-597 SUBFAMILY NOT NAMED

ESRERRRRQMRATSPSKPGILVVTIHEGQGFSLPEQHRAAFGMGNQHSSSVSTGNGFGVAGSVRPGSSQKSPGVFNGRPQTSGGGFGTLPTNHGRFSGKYMPYALIDFDKVQVFVNSVEGSPDNPLWAGSNTQYKFDVSRVTELTIHLYIRNPNAPPGSGRSQDIFLGVCRIQPRFEERQPFVEDPKMSKKDKEKAQAEWAKRERALGFSGVEWADVQYGTGRLKIGVEFVANRTGKLKLDEDFELLKVVGKGSFGKVMQVRKKDTNRIYALKTIRKAHIISRSEVTHTLAERSVLAQINNPFIVPLKFAFQSPEKLYFVLAFVNGGELFHHLQKEQRFDVNRSRFYTAELICALECLHGFNVVYRDLKPENILLDYQGHIALCDFGLCKLDMKDEDHTNTFCGTPEYLAPELLEGKGYDKAVDWWTLGVLLYEMLTGLPPFYDENTNEMYKKILYQPLDFPGPEVVPPAAQDLLRKLLDRDPKTRLGSPERGRGAAEIKSHPFFHAIDWRKLLQRKYEPAFKPSVANALDTTNFDPEFTSEAPQDSYVEGPVLSQTMQDQFQGFSYNRPIAGLDDAGGSVKDPSFVGSL

HMMPanther: PTHR24354
8-597 FAMILY NOT NAMED,SERINE/THREONINE-PROTEIN KINASE YPK-RELATED

ESRERRRRQMRATSPSKPGILVVTIHEGQGFSLPEQHRAAFGMGNQHSSSVSTGNGFGVAGSVRPGSSQKSPGVFNGRPQTSGGGFGTLPTNHGRFSGKYMPYALIDFDKVQVFVNSVEGSPDNPLWAGSNTQYKFDVSRVTELTIHLYIRNPNAPPGSGRSQDIFLGVCRIQPRFEERQPFVEDPKMSKKDKEKAQAEWAKRERALGFSGVEWADVQYGTGRLKIGVEFVANRTGKLKLDEDFELLKVVGKGSFGKVMQVRKKDTNRIYALKTIRKAHIISRSEVTHTLAERSVLAQINNPFIVPLKFAFQSPEKLYFVLAFVNGGELFHHLQKEQRFDVNRSRFYTAELICALECLHGFNVVYRDLKPENILLDYQGHIALCDFGLCKLDMKDEDHTNTFCGTPEYLAPELLEGKGYDKAVDWWTLGVLLYEMLTGLPPFYDENTNEMYKKILYQPLDFPGPEVVPPAAQDLLRKLLDRDPKTRLGSPERGRGAAEIKSHPFFHAIDWRKLLQRKYEPAFKPSVANALDTTNFDPEFTSEAPQDSYVEGPVLSQTMQDQFQGFSYNRPIAGLDDAGGSVKDPSFVGSL

Seg: seg
244-255 seg

KLKLDEDFELLK

superfamily: SSF56112
IPR011009
246-578 Protein kinase-like (PK-like)
Protein kinase-like domain

KLDEDFELLKVVGKGSFGKVMQVRKKDTNRIYALKTIRKAHIISRSEVTHTLAERSVLAQINNPFIVPLKFAFQSPEKLYFVLAFVNGGELFHHLQKEQRFDVNRSRFYTAELICALECLHGFNVVYRDLKPENILLDYQGHIALCDFGLCKLDMKDEDHTNTFCGTPEYLAPELLEGKGYDKAVDWWTLGVLLYEMLTGLPPFYDENTNEMYKKILYQPLDFPGPEVVPPAAQDLLRKLLDRDPKTRLGSPERGRGAAEIKSHPFFHAIDWRKLLQRKYEPAFKPSVANALDTTNFDPEFTSEAPQDSYVEGPVLSQTMQDQFQGFSYNRPI

Gene3D: G3DSA:3.30.200.20
249-333 no description

EDFELLKVVGKGSFGKVMQVRKKDTNRIYALKTIRKAHIISRSEVTHTLAERSVLAQINNPFIVPLKFAFQSPEKLYFVLAFVNG

HMMPfam: PF00069
IPR017442
251-512 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

FELLKVVGKGSFGKVMQVRKKDTNRIYALKTIRKAHIISRSEVTHTLAERSVLAQINNPFIVPLKFAFQSPEKLYFVLAFVNGGELFHHLQKEQRFDVNRSRFYTAELICALECLHGFNVVYRDLKPENILLDYQGHIALCDFGLCKLDMKDEDHTNTFCGTPEYLAPELLEGKGYDKAVDWWTLGVLLYEMLTGLPPFYDENTNEMYKKILYQPLDFPGPEVVPPAAQDLLRKLLDRDPKTRLGSPERGRGAAEIKSHPFF

ProfileScan: PS50011
IPR000719
251-512 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FELLKVVGKGSFGKVMQVRKKDTNRIYALKTIRKAHIISRSEVTHTLAERSVLAQINNPFIVPLKFAFQSPEKLYFVLAFVNGGELFHHLQKEQRFDVNRSRFYTAELICALECLHGFNVVYRDLKPENILLDYQGHIALCDFGLCKLDMKDEDHTNTFCGTPEYLAPELLEGKGYDKAVDWWTLGVLLYEMLTGLPPFYDENTNEMYKKILYQPLDFPGPEVVPPAAQDLLRKLLDRDPKTRLGSPERGRGAAEIKSHPFF

HMMSmart: SM00219
IPR020635
251-503 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FELLKVVGKGSFGKVMQVRKKDTNRIYALKTIRKAHIISRSEVTHTLAERSVLAQINNPFIVPLKFAFQSPEKLYFVLAFVNGGELFHHLQKEQRFDVNRSRFYTAELICALECLHGFNVVYRDLKPENILLDYQGHIALCDFGLCKLDMKDEDHTNTFCGTPEYLAPELLEGKGYDKAVDWWTLGVLLYEMLTGLPPFYDENTNEMYKKILYQPLDFPGPEVVPPAAQDLLRKLLDRDPKTRLGSPERGRGA

HMMSmart: SM00220
IPR002290
251-512 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FELLKVVGKGSFGKVMQVRKKDTNRIYALKTIRKAHIISRSEVTHTLAERSVLAQINNPFIVPLKFAFQSPEKLYFVLAFVNGGELFHHLQKEQRFDVNRSRFYTAELICALECLHGFNVVYRDLKPENILLDYQGHIALCDFGLCKLDMKDEDHTNTFCGTPEYLAPELLEGKGYDKAVDWWTLGVLLYEMLTGLPPFYDENTNEMYKKILYQPLDFPGPEVVPPAAQDLLRKLLDRDPKTRLGSPERGRGAAEIKSHPFF

PatternScan: PS00107
IPR017441
257-284 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

VGKGSFGKVMQVRKKDTNRIYALKTIRK

Gene3D: G3DSA:1.10.510.10
334-568 no description

GELFHHLQKEQRFDVNRSRFYTAELICALECLHGFNVVYRDLKPENILLDYQGHIALCDFGLCKLDMKDEDHTNTFCGTPEYLAPELLEGKGYDKAVDWWTLGVLLYEMLTGLPPFYDENTNEMYKKILYQPLDFPGPEVVPPAAQDLLRKLLDRDPKTRLGSPERGRGAAEIKSHPFFHAIDWRKLLQRKYEPAFKPSVANALDTTNFDPEFTSEAPQDSYVEGPVLSQTMQDQ

PatternScan: PS00108
IPR008271
370-382 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VVYRDLKPENILL

Seg: seg
480-494 seg

DLLRKLLDRDPKTRL

ProfileScan: PS51285
IPR000961
513-584 AGC_KINASE_CTER
AGC-kinase, C-terminal

HAIDWRKLLQRKYEPAFKPSVANALDTTNFDPEFTSEAPQDSYVEGPVLSQTMQDQFQGFSYNRPIAGLDDA

HMMSmart: SM00133
IPR000961
513-576 Extension to Ser/Thr-type protein kinases
AGC-kinase, C-terminal

HAIDWRKLLQRKYEPAFKPSVANALDTTNFDPEFTSEAPQDSYVEGPVLSQTMQDQFQGFSYNR

HMMPfam: PF00433
IPR017892
533-577 Pkinase_C
Protein kinase, C-terminal

VANALDTTNFDPEFTSEAPQDSYVEGPVLSQTMQDQFQGFSYNRP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox