PRGDB00071119 (Mgr.13440)

From PRG Wiki
Jump to: navigation, search
Mgr.13440
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 39964958 (XM_365053)
Gene Class RLP
Domain Type NBS, Ser-Thr Kinase, LRR
Gene Species Magnaporthe grisea

Comment?

Magnaporthe grisea 70-15 hypothetical protein (MGG_09898) partial mRNA

DNA Sequence

ATGACCAGGAACGACGCCCTGTCCCGTTTCAGCTCCATTACGAGCTCCTCCACAGACAGTGCACACTCAACGGCTACCGTTAAGCCGTTGCCATCAACGCCTATCGCCAGCGATACACGAAGACATTCAAGCGGCTCTCGACCAGCCATCCCGTCGCGCCTCAGGATTGACGATGATTTGAACCGTATTACCGCCTCTCCGCTCAGAGACGACACGCAGGTATCACCGACAAACACGTTCGGCACGCGCGTTGCATTATCACCATCATCTCCCACCTCCAATGTATTCCCCCGCGAGCAACGACTGAGCGACTTCGGGAACTATCGAAGGGACCTCGCCGTGCTGGATCCCGGCGGCAGTCGAGTGCCTCAAATCCAGCAGCCTCCGCCGAACACGGGGCCGTCCCTGAGCAGCCAAGTTGCTCCCTGGATGACCTCCAACGGCACCGGCGGCGCTCCAGCCGCCATCAACACCAGCTTCTACAATGATTCAAGCGACAACCTCTCGGTCGCGTCACAGCTCTCCCCTGGCTTCCGAATACCCGGCGGCAGACCGTCGATTTCGCAACCCTCGGGTGTAGGCGCCGATAACAATGAGGCATCATACTTTGGCGACGAACGAAGGCCGTCGATAGCCAGCATCACAACGACTGCGAGCAGCCAGGGCTCCAAAGCCAGCGGGAACAGGGGTGGCTTTCGAAAGCTGCAGGGCTTCTTTGGAGAGGAGTTTCCCGGCCGAGATTCCTCCGACACTAGTCTTCCACCTGCCGTTCCGGGCAAGGAGCACCGCTCACACTCGTACAGCCACGGCCGACCGTACCGAGACCGCAACTATTCCAACGCTACTGACCATACTCGGGACGGATCACCGTCGTCGTCCAGACCCAGAACACCAGTGCCTGCCCCAGAGGTAGTGCCATTCTTGTATCAAGAAGCTGATGACATTGCAAAATATGGCGAAGCTCCTGTCAGGGATATCCTGTCTGGCCCCGATCGTGAACGTTATGTGACCGGCGATTCATTACAAAACCCACCCAAGACCTCATCTTCATCGCGATCCGGTCATTCTCTCGCCCACCTGTCGGGTCAACATCGACACCAGAAAAGTAACGATGACCCGAGAACTTTGCGCCCTACCATGAGCCGGGACGACTCTGCTGTTCCCACCTACAAGGACCGTAGCGGGTCTGCCACCACCATGATGACAACCTCCAGAGACCGCGCCCACAGCCCGGCCCCGAGCGGACACAGCATCGGTGGTTACTTCAGCTCGAAAAACGGTACCTACGATGGTCAAACTTCGCCGCCTGGGCATCAAAAGAAGAGCCTGCTTGGTCGCTTCAAGAGGAACAAAGACAAGGAGGACACGGGTTCGCTCAAGAAAACTTCTCTCTCGAGCACCTCGCTCAATTTGAAACCTTCACGATCGGAATTTGGAGGGGATGGGGCATCTACCATGGGTCAGGATTGGCCCTCGCGCCTAGCGGAACCGTCTCAATACAATTCCAACTCCAACTCTGCCTCGGCACGACCGCCGCAAGCCCGACACGGTACTTTCAAATCGCCATTTGCGAAGCGAGGGCGTACTCATCACAGGCATGACGATCGCGACGAGGCTATCGGGCCCACCGATAAGCACGATGGGATGCAAGCAGGTGGAACCATGTTCCATCTCGATACTGACCTCAATGACATGAGCGGCATCCTAAGCCGACCTCTGCCCTTGACCCCTATGGACGCTGATTTCGTTGGTACCATCAAGGGCGAGAAGTCCACTGTCACTTCCAATGGCCGCAACGGCGCTTGGGACGCCCCCGACAGCTGGGCTGTCAAGCGAACAGGTGACGATTTAGCCTACCACGGACCGGAGAATGACGAGGCTGGCCCGTCACCGAGACCAGAAGAGAAGATGACCTCTTACTGCATACGCGTGTTCAAGTCGGACGGCACGTTTGCAACTTTGCAGATGTCAATCGACTCGTCGGTCCAGGACCTCATCGGGCAGCTGTCTAAGAAGTCATATGTCTCTGGTGGTCTCGAGTACCACATCGCTCTACGCAAACACGGCCTCATCCGCGTGCTCGGCTCTGCAGAGAAGCCGCTCTTTATACAAAAACGTCTATTACGACAGGTGGGTTTCGAGGAGAGGGATCGTATTGAAGACATTGGTCGTGAGGACAACAGTTACCTCTGTCGCTTTCTTTTCATGTCCTCGCGAGAGCTCGAGCAACAGGCACGAACCCAGGATCTAGGCCTGGGCCGGACGCAAAAGTTCAACCACGTGGACCTGTCGGCGCGCAATATTATCCGAATCCCCATCTACCTCTACTCCAAGGTTCAGGACATCATCTCTCTTAATCTATCGAAAAACCTGTCCCTGGACTTACCGCGCGACTTCATATCGTCTTGCCAGAATCTTCGCGATATCAAGTTCAACAACAACGAGGCCAGGAAACTCCCAGCCAGTCTTGGGCGTGCGAGCAGGCTTACGTATCTTGACGTGTCCAACAACCGGATTGACCATTTGGAGAATGCTGAGCTCAACGGTCTCGTTGGCCTTTTGAAGCTTAATCTTGCCAACAACAGACTTAAGCACCTGCCTCCATACTTTGGTGCTTATCGGTCTCTGAGGACCCTCAATGTGTCTTCTAACTTTTTGGACAAATTCCCATCCTTCCTCTGTGAGCTCGAGAGTTTAGTCGACCTCGATCTGAGCTTCAACCTGATTGGAGCCTTCCCGCCAGCTATTGAGAACCTGCGAAACCTCGAGAAACTTGTCATCACAAACAACAGGTTAGCAGGCACACTGCCAGACAGCTTCAGCCGTCTCCAAAGTCTTAGAGAGCTCGACATCAAGTACAATGCAATTTCGGGCATCGATGTGATATCTCTGTTGCCAAAGCTCGAGATTTTGGCTGCAGATCACAACGCCATTTCTCAGTTTGTTGGCTCCTTCGAAAGAGTCAGGAGTCTGAAGCTCAAGGACAACCCCATCACGCGGTTCGAGCTGACATCGACGGTCCCAACGCTAAAACTGCTCAACTTGTCGAACGCCAAACTCGCTAGTATCGCTGAGTCTTTTAATCACATGCTCAACCTAGAAAGGCTTGTTTTGGATAGAAACCATTTCGTCTCTTTGCCATCCCAGATTGGCAGACTGCGGCGACTGGAACACTTCAGCATCGCCCACAACGCGCTGGCCGAGCTCCCACCGGAGGTAGGATGCCTTCAGGAGCTCAAATTCCTCGATGTGCGCGGCAACAATCTCAAAAAGCTACCATTGGAGATTTGGTGGGCAAACAAGCTGGAGACACTCAACGCCTCGTCCAACGTCATGACGGATTTCCCCAAGCCGGCGTCAAGACCACCCCAACCTCCCGAGTCGAGTCCCGGTTCTATGCAGGGTTCTAATGGTAAAGTTGCTATGGTTGGCTCATTATCGACCCCGCCTAGTATAGAAGACCTCGATCCCGACGACTCTAGACGACCCAGCCAGGCCTCTTCCAGCACTTTGCTGAGTGTGGGACCATCACCCGTCCCAGCCGGGCCGGACCGCAAGAGCTCAGTGGTGTCTGTCTACGGCAAGGGTGGCCGCAAGACGTCCATCATATCGAGGAGTGCCAACTCGAGCGGCAACGCCCCTGCGCCCCCTAACACTAGAAAAGACTCAGGGCTGTCGGCACGTATTACCAACACCTTCTCGGGCTCGTTGCGAAATCTTTTCCTCGCGGATAACCTGTTGGACGATGACGTGTTTGACCAGATAATGCTTCTGTGCGAGCTTCGTGTACTCAATCTTTCGTTCAACCAAATCAGTGACATGCCGCAGCGATGCATAAAGAGCTGGCCGCAGCTATCGGAGCTATATTTGTCCGGCAATGAGCTCACAACAATACCAGTTGACGACCTGGAGGAATACAGTCTGCTTCAGGTCCTTCACATCAACTGCAACAAATTCACCAATCTGCCGGCTGACATATCAAGAGCCAAGAAGCTGGCAGTGCTGGACTGTGGCAGCAACTTCCTCAAGTACAACATTAGCAATGTACCATATGACTGGAATTGGAACCTCAATCCAAACCTGAGATATCTGAACCTTTCGGGCAACCGGCGGCTGGAAATAAAGCAACCAGCCTATGGTAGTGGCGCCGGGAATAGGGAGCAGTACACAGATTTCAGTAGGTTGCAAAACCTGCGGGTCTTGGGTCTCATGGATGTCACTCTCACCCAGCCTAGTATTCCGGAGCAGAGCGAGGACTGCAGAGTAAGGACGTCGGGCTCCTCGGCCGGTTATCTGCCTTATGCCATGGCCGACACGCTTGGCAAAAATGAGCATCTGTCGACGGTCGACTTGGTTGTGCCGCGGTTCAATGCATCCGAGACGGAGACGCTGCTAGGCTTGTTTGACGGCCAGGCTCTTTCAAGTGGTGGCTCTAAGATAGCCAAGTATCTACATGAGAACTTTGGTCAGATTCTGGCTACAGAGTTGAGAGCACTCAAGACCGGCCTCAAGGAGACGCCAGAGGATGCGCTGCGACGTGCATTCTTGGCGCTCAACAAGGAGCTGGTGACCATTGCGATCCAGCACAGCGAGGACCGGCCGTCTGTGCCACACCGCAGCGGCTCTCAGGCCCACGTAATCCTCAACAAGGAAGATCTCAACTCGGGAGGCGTGGCAACAGTCGTCTATCTTCAAGGGCAGGATCTCTACGTTGCCAACGTTGGAGATGCGCAGGCCATGATTATCCAGTCGGACCAAACACACAAGATGCTGACGAGGAAACATGATCCGGCAGAGCCCACGGAGCGTAGCCGAATCCGAGAGGCGGGAGGTTGGGTATCTCGAAACGGCAAGCTGAACGACCAGCTCGGTGTGTCGAGAGCTTTCGGCTATGTCGACTTGATGCCAGCCGTGCAGGCGGCTCCCCACGTCAGCCATGTGGCAATCAGGGAGCAGGACGAGATGATACTGCTGGCCACAAGCGAACTCTGGGAACACCTGGCGCCTGAGCTGATAGTGGACATAGCTCGACAGGAGCGCGGTGATCTTATGAGGGCAACCCAAAAGCTTCGCGACCTAGCCATTGCTTACGGCTCGACCAACAAAATTATGATTATGATGATCAGTGTGGCGGACCTGAAGCGGAGGACCGAACGCACTCGAATTAATAGAGGTCAGAGCATGTCCATTCACAACTTGAGTCTCCACGGCGAGCAGTACAAGTTCCCCACCAGGGGACGGCGCAAGAAGGACCAGGTCATGGACTCGACGCTGCAGCGTCTAGAGGCAGAAGTCCCAGCGCCCACGGGTATGATCGCCATTGTCTTCACGGATATCAAGAACTCGACGAACCTGTGGGAGACGTACCCGGCCGCGATGAGGTCTGCCATCAGGCTGCACAATGAGATGATGAGGAGACAACTGCGTCGCATCGGTGGATTTGAGGTCAAGACTGAAGGTGACGCCTTCATGGTATCGTTTCCCACAGCGACATCGGCTCTGCTCTGGTGTTTTGCTGTGCAGCTGCAACTGCTCGAGGTCAACTGGCCGTCTGAGATGCTCAACTCGCTCTCGTGCAAACCAACGGTTGATAAGAATAACCAGGTCATCTTCAAGGGACTGTCGGTCCGCATGGGTATTCATTGGGGCGAGCCACTCTGTGAGCCAGATCCCATCACACGTCGTATGGACTATTACGGTCCGATGGTGAACAAGGCGTCTCGTATCTCAGCCGTTGCCGACGGAGGGCAGATCACGGTTTCATCCGACTTCATCTCGGAGATTCAGAGATGCCTGGAGACTTACCAGGGAGCAAACGCCGCCGCTTTGGTAAACGAGTCCTTTGATGAGGACCCCTTCTCGATGGCGATCCGAAAGGAGCTACGGTCACTCAGCAGCCAAGGCTTTGAGGTCAAGGAGCTGGGTGAGCGCAAACTGAAGGGTCTCGAGAACCCAGAGGTGGTGTATTCTCTTTACCCACACCAGCTGGCGGGTCGCATCGAAACGCATCAGGCACACGATAAGGGCGTGACGGCTGCTGCTCCCGAGTTGATCGAGAACACGCCAGCGGTTCTCAAGGAGGGTTCGGAGCTCGACTTTGACCCAGAGATCATATGGGGTCTGTGGAAGCTGAGCCTTCGGCTCGAAATGCTGTGCAGCAGTCTTGAATACGTGGGAGGTCGTGGGCTGCAGGCGCCCGAGACGGAGCTGCTCGAGAGGATGAAGCAGAGGGGTGGAGAGGTCACGGAGAGCTTTCTGGTCAACTTCATGGAGCACCAGATCAGCCGCATCGAGACCTGCGTCTCCACACTCAGCATTAGACACCTCAACATGGGGGGCGGCACTATCAAGGAGCTCGACGACCTCCGTGGGCCCATCTCCAGCGTCCTGGCCAACTTTAGCAAGCAGATGGCCGAGCTTCAACGCTACAAAGCGCTCTACGGGCCACTTGATGCGATTGAGGATGGCCAGCAAGCATCTTAA


Protein sequences

Name Description Sequence
Mgr.13440 translated coding region predicted by ESTScan from UniGene Mgr.13440

MTRNDALSRFSSITSSSTDSAHSTATVKPLPSTPIASDTRRHSSGSRPAIPSRLRIDDDLNRITASPLRDDTQVSPTNTFGTRVALSPSSPTSNVFPREQRLSDFGNYRRDLAVLDPGGSRVPQIQQPPPNTGPSLSSQVAPWMTSNGTGGAPAAINTSFYNDSSDNLSVASQLSPGFRIPGGRPSISQPSGVGADNNEASYFGDERRPSIASITTTASSQGSKASGNRGGFRKLQGFFGEEFPGRDSSDTSLPPAVPGKEHRSHSYSHGRPYRDRNYSNATDHTRDGSPSSSRPRTPVPAPEVVPFLYQEADDIAKYGEAPVRDILSGPDRERYVTGDSLQNPPKTSSSSRSGHSLAHLSGQHRHQKSNDDPRTLRPTMSRDDSAVPTYKDRSGSATTMMTTSRDRAHSPAPSGHSIGGYFSSKNGTYDGQTSPPGHQKKSLLGRFKRNKDKEDTGSLKKTSLSSTSLNLKPSRSEFGGDGASTMGQDWPSRLAEPSQYNSNSNSASARPPQARHGTFKSPFAKRGRTHHRHDDRDEAIGPTDKHDGMQAGGTMFHLDTDLNDMSGILSRPLPLTPMDADFVGTIKGEKSTVTSNGRNGAWDAPDSWAVKRTGDDLAYHGPENDEAGPSPRPEEKMTSYCIRVFKSDGTFATLQMSIDSSVQDLIGQLSKKSYVSGGLEYHIALRKHGLIRVLGSAEKPLFIQKRLLRQVGFEERDRIEDIGREDNSYLCRFLFMSSRELEQQARTQDLGLGRTQKFNHVDLSARNIIRIPIYLYSKVQDIISLNLSKNLSLDLPRDFISSCQNLRDIKFNNNEARKLPASLGRASRLTYLDVSNNRIDHLENAELNGLVGLLKLNLANNRLKHLPPYFGAYRSLRTLNVSSNFLDKFPSFLCELESLVDLDLSFNLIGAFPPAIENLRNLEKLVITNNRLAGTLPDSFSRLQSLRELDIKYNAISGIDVISLLPKLEILAADHNAISQFVGSFERVRSLKLKDNPITRFELTSTVPTLKLLNLSNAKLASIAESFNHMLNLERLVLDRNHFVSLPSQIGRLRRLEHFSIAHNALAELPPEVGCLQELKFLDVRGNNLKKLPLEIWWANKLETLNASSNVMTDFPKPASRPPQPPESSPGSMQGSNGKVAMVGSLSTPPSIEDLDPDDSRRPSQASSSTLLSVGPSPVPAGPDRKSSVVSVYGKGGRKTSIISRSANSSGNAPAPPNTRKDSGLSARITNTFSGSLRNLFLADNLLDDDVFDQIMLLCELRVLNLSFNQISDMPQRCIKSWPQLSELYLSGNELTTIPVDDLEEYSLLQVLHINCNKFTNLPADISRAKKLAVLDCGSNFLKYNISNVPYDWNWNLNPNLRYLNLSGNRRLEIKQPAYGSGAGNREQYTDFSRLQNLRVLGLMDVTLTQPSIPEQSEDCRVRTSGSSAGYLPYAMADTLGKNEHLSTVDLVVPRFNASETETLLGLFDGQALSSGGSKIAKYLHENFGQILATELRALKTGLKETPEDALRRAFLALNKELVTIAIQHSEDRPSVPHRSGSQAHVILNKEDLNSGGVATVVYLQGQDLYVANVGDAQAMIIQSDQTHKMLTRKHDPAEPTERSRIREAGGWVSRNGKLNDQLGVSRAFGYVDLMPAVQAAPHVSHVAIREQDEMILLATSELWEHLAPELIVDIARQERGDLMRATQKLRDLAIAYGSTNKIMIMMISVADLKRRTERTRINRGQSMSIHNLSLHGEQYKFPTRGRRKKDQVMDSTLQRLEAEVPAPTGMIAIVFTDIKNSTNLWETYPAAMRSAIRLHNEMMRRQLRRIGGFEVKTEGDAFMVSFPTATSALLWCFAVQLQLLEVNWPSEMLNSLSCKPTVDKNNQVIFKGLSVRMGIHWGEPLCEPDPITRRMDYYGPMVNKASRISAVADGGQITVSSDFISEIQRCLETYQGANAAALVNESFDEDPFSMAIRKELRSLSSQGFEVKELGERKLKGLENPEVVYSLYPHQLAGRIETHQAHDKGVTAAAPELIENTPAVLKEGSELDFDPEIIWGLWKLSLRLEMLCSSLEYVGGRGLQAPETELLERMKQRGGEVTESFLVNFMEHQISRIETCVSTLSIRHLNMGGGTIKELDDLRGPISSVLANFSKQMAELQRYKALYGPLDAIEDGQQAS

Domains

Domain Start-End Description Sequence

Seg: seg
6-26 seg

ALSRFSSITSSSTDSAHSTAT

Seg: seg
210-220 seg

SIASITTTASS

Seg: seg
289-302 seg

SPSSSRPRTPVPAP

Seg: seg
348-362 seg

SSSSRSGHSLAHLSG

Seg: seg
456-474 seg

TGSLKKTSLSSTSLNLKPS

Seg: seg
497-515 seg

PSQYNSNSNSASARPPQAR

Seg: seg
528-537 seg

RTHHRHDDRD

HMMPfam: PF08509
IPR013716
537-591 Ad_cyc_g-alpha
Adenylate cyclase G-alpha binding

DEAIGPTDKHDGMQAGGTMFHLDTDLNDMSGILSRPLPLTPMDADFVGTIKGEKS

HMMSmart: SM00789
IPR013716
537-592 Adenylate cyclase G-alpha binding doma
Adenylate cyclase G-alpha binding

DEAIGPTDKHDGMQAGGTMFHLDTDLNDMSGILSRPLPLTPMDADFVGTIKGEKST

ProfileScan: PS50200
IPR000159
638-728 RA
Ras-association

TSYCIRVFKSDGTFATLQMSIDSSVQDLIGQLSKKSYVSGGLEYHIALRKHGLIRVLGSAEKPLFIQKRLLRQVGFEERDRIEDIGREDNS

HMMSmart: SM00314
IPR000159
638-718 Ras association (RalGDS/AF-6) domain
Ras-association

TSYCIRVFKSDGTFATLQMSIDSSVQDLIGQLSKKSYVSGGLEYHIALRKHGLIRVLGSAEKPLFIQKRLLRQVGFEERDR

HMMPfam: PF00788
IPR000159
639-710 RA
Ras-association

SYCIRVFKSDGTFATLQMSIDSSVQDLIGQLSKKSYVSGGLEYHIALRKHGLIRVLGSAEKPLFIQKRLLRQ

HMMPanther: PTHR23155:SF263
654-1854 ADENYLATE CYCLASE,ADENYLATE CYCLASE

LQMSIDSSVQDLIGQLSKKSYVSGGLEYHIALRKHGLIRVLGSAEKPLFIQKRLLRQVGFEERDRIEDIGREDNSYLCRFLFMSSRELEQQARTQDLGLGRTQKFNHVDLSARNIIRIPIYLYSKVQDIISLNLSKNLSLDLPRDFISSCQNLRDIKFNNNEARKLPASLGRASRLTYLDVSNNRIDHLENAELNGLVGLLKLNLANNRLKHLPPYFGAYRSLRTLNVSSNFLDKFPSFLCELESLVDLDLSFNLIGAFPPAIENLRNLEKLVITNNRLAGTLPDSFSRLQSLRELDIKYNAISGIDVISLLPKLEILAADHNAISQFVGSFERVRSLKLKDNPITRFELTSTVPTLKLLNLSNAKLASIAESFNHMLNLERLVLDRNHFVSLPSQIGRLRRLEHFSIAHNALAELPPEVGCLQELKFLDVRGNNLKKLPLEIWWANKLETLNASSNVMTDFPKPASRPPQPPESSPGSMQGSNGKVAMVGSLSTPPSIEDLDPDDSRRPSQASSSTLLSVGPSPVPAGPDRKSSVVSVYGKGGRKTSIISRSANSSGNAPAPPNTRKDSGLSARITNTFSGSLRNLFLADNLLDDDVFDQIMLLCELRVLNLSFNQISDMPQRCIKSWPQLSELYLSGNELTTIPVDDLEEYSLLQVLHINCNKFTNLPADISRAKKLAVLDCGSNFLKYNISNVPYDWNWNLNPNLRYLNLSGNRRLEIKQPAYGSGAGNREQYTDFSRLQNLRVLGLMDVTLTQPSIPEQSEDCRVRTSGSSAGYLPYAMADTLGKNEHLSTVDLVVPRFNASETETLLGLFDGQALSSGGSKIAKYLHENFGQILATELRALKTGLKETPEDALRRAFLALNKELVTIAIQHSEDRPSVPHRSGSQAHVILNKEDLNSGGVATVVYLQGQDLYVANVGDAQAMIIQSDQTHKMLTRKHDPAEPTERSRIREAGGWVSRNGKLNDQLGVSRAFGYVDLMPAVQAAPHVSHVAIREQDEMILLATSELWEHLAPELIVDIARQERGDLMRATQKLRDLAIAYGSTNKIMIMMISVADLKRRTERTRINRGQSMSIHNLSLHGEQYKFPTRGRRKKDQVMDSTLQRLEAEVPAPTGMIAIVFTDIKNSTNLWETYPAAMRSAIRLHNEMMRRQLRRIGGFEVKTEGDAFMVSFPTATSALLWCFAVQLQLLEVNWPSEML

HMMPanther: PTHR23155
654-1854 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LQMSIDSSVQDLIGQLSKKSYVSGGLEYHIALRKHGLIRVLGSAEKPLFIQKRLLRQVGFEERDRIEDIGREDNSYLCRFLFMSSRELEQQARTQDLGLGRTQKFNHVDLSARNIIRIPIYLYSKVQDIISLNLSKNLSLDLPRDFISSCQNLRDIKFNNNEARKLPASLGRASRLTYLDVSNNRIDHLENAELNGLVGLLKLNLANNRLKHLPPYFGAYRSLRTLNVSSNFLDKFPSFLCELESLVDLDLSFNLIGAFPPAIENLRNLEKLVITNNRLAGTLPDSFSRLQSLRELDIKYNAISGIDVISLLPKLEILAADHNAISQFVGSFERVRSLKLKDNPITRFELTSTVPTLKLLNLSNAKLASIAESFNHMLNLERLVLDRNHFVSLPSQIGRLRRLEHFSIAHNALAELPPEVGCLQELKFLDVRGNNLKKLPLEIWWANKLETLNASSNVMTDFPKPASRPPQPPESSPGSMQGSNGKVAMVGSLSTPPSIEDLDPDDSRRPSQASSSTLLSVGPSPVPAGPDRKSSVVSVYGKGGRKTSIISRSANSSGNAPAPPNTRKDSGLSARITNTFSGSLRNLFLADNLLDDDVFDQIMLLCELRVLNLSFNQISDMPQRCIKSWPQLSELYLSGNELTTIPVDDLEEYSLLQVLHINCNKFTNLPADISRAKKLAVLDCGSNFLKYNISNVPYDWNWNLNPNLRYLNLSGNRRLEIKQPAYGSGAGNREQYTDFSRLQNLRVLGLMDVTLTQPSIPEQSEDCRVRTSGSSAGYLPYAMADTLGKNEHLSTVDLVVPRFNASETETLLGLFDGQALSSGGSKIAKYLHENFGQILATELRALKTGLKETPEDALRRAFLALNKELVTIAIQHSEDRPSVPHRSGSQAHVILNKEDLNSGGVATVVYLQGQDLYVANVGDAQAMIIQSDQTHKMLTRKHDPAEPTERSRIREAGGWVSRNGKLNDQLGVSRAFGYVDLMPAVQAAPHVSHVAIREQDEMILLATSELWEHLAPELIVDIARQERGDLMRATQKLRDLAIAYGSTNKIMIMMISVADLKRRTERTRINRGQSMSIHNLSLHGEQYKFPTRGRRKKDQVMDSTLQRLEAEVPAPTGMIAIVFTDIKNSTNLWETYPAAMRSAIRLHNEMMRRQLRRIGGFEVKTEGDAFMVSFPTATSALLWCFAVQLQLLEVNWPSEML

Seg: seg
714-726 seg

EERDRIEDIGRED

superfamily: SSF52058
724-1134 L domain-like,LRR

REDNSYLCRFLFMSSRELEQQARTQDLGLGRTQKFNHVDLSARNIIRIPIYLYSKVQDIISLNLSKNLSLDLPRDFISSCQNLRDIKFNNNEARKLPASLGRASRLTYLDVSNNRIDHLENAELNGLVGLLKLNLANNRLKHLPPYFGAYRSLRTLNVSSNFLDKFPSFLCELESLVDLDLSFNLIGAFPPAIENLRNLEKLVITNNRLAGTLPDSFSRLQSLRELDIKYNAISGIDVISLLPKLEILAADHNAISQFVGSFERVRSLKLKDNPITRFELTSTVPTLKLLNLSNAKLASIAESFNHMLNLERLVLDRNHFVSLPSQIGRLRRLEHFSIAHNALAELPPEVGCLQELKFLDVRGNNLKKLPLEIWWANKLETLNASSNVMTDFPKPASRPPQPPESSPGSMQ

Gene3D: G3DSA:3.80.10.10
754-826 no description

RTQKFNHVDLSARNIIRIPIYLYSKVQDIISLNLSKNLSLDLPRDFISSCQNLRDIKFNNNEARKLPASLGRA

Seg: seg
781-795 seg

DIISLNLSKNLSLDL

HMMSmart: SM00364
826-844 Leucine-rich repeats, bacterial type

ASRLTYLDVSNNRIDHLEN

HMMSmart: SM00365
826-847 Leucine-rich repeat, SDS22-like subfam

ASRLTYLDVSNNRIDHLENAEL

HMMSmart: SM00369
IPR003591
827-849 Leucine-rich repeats, typical (most po
Leucine-rich repeat, typical subtype

SRLTYLDVSNNRIDHLENAELNG

Gene3D: G3DSA:3.80.10.10
827-931 no description

SRLTYLDVSNNRIDHLENAELNGLVGLLKLNLANNRLKHLPPYFGAYRSLRTLNVSSNFLDKFPSFLCELESLVDLDLSFNLIGAFPPAIENLRNLEKLVITNNR

HMMPfam: PF13855
827-884 LRR_8,Leucine rich repeat

SRLTYLDVSNNRIDHLENAELNGLVGLLKLNLANNRLKHLPPYFGAYRSLRTLNVSSN

ProfileScan: PS51450
IPR001611
828-849 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RLTYLDVSNNRIDHLENAELNG

Seg: seg
847-866 seg

LNGLVGLLKLNLANNRLKHL

HMMSmart: SM00364
850-869 Leucine-rich repeats, bacterial type

LVGLLKLNLANNRLKHLPPY

HMMSmart: SM00369
IPR003591
850-872 Leucine-rich repeats, typical (most po
Leucine-rich repeat, typical subtype

LVGLLKLNLANNRLKHLPPYFGA

ProfileScan: PS51450
IPR001611
852-873 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

GLLKLNLANNRLKHLPPYFGAY

ProfileScan: PS51450
IPR001611
875-896 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLRTLNVSSNFLDKFPSFLCEL

HMMSmart: SM00364
875-892 Leucine-rich repeats, bacterial type

SLRTLNVSSNFLDKFPSF

HMMSmart: SM00369
IPR003591
896-918 Leucine-rich repeats, typical (most po
Leucine-rich repeat, typical subtype

LESLVDLDLSFNLIGAFPPAIEN

HMMSmart: SM00365
896-921 Leucine-rich repeat, SDS22-like subfam

LESLVDLDLSFNLIGAFPPAIENLRN

ProfileScan: PS51450
IPR001611
898-920 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLVDLDLSFNLIGAFPPAIENLR

HMMPfam: PF13855
898-956 LRR_8,Leucine rich repeat

SLVDLDLSFNLIGAFPPAIENLRNLEKLVITNNRLAGTLPDSFSRLQSLRELDIKYNAI

HMMSmart: SM00364
919-939 Leucine-rich repeats, bacterial type

LRNLEKLVITNNRLAGTLPDS

HMMSmart: SM00369
IPR003591
919-942 Leucine-rich repeats, typical (most po
Leucine-rich repeat, typical subtype

LRNLEKLVITNNRLAGTLPDSFSR

ProfileScan: PS51450
IPR001611
921-943 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLEKLVITNNRLAGTLPDSFSRL

Gene3D: G3DSA:3.80.10.10
932-1117 no description

LAGTLPDSFSRLQSLRELDIKYNAISGIDVISLLPKLEILAADHNAISQFVGSFERVRSLKLKDNPITRFELTSTVPTLKLLNLSNAKLASIAESFNHMLNLERLVLDRNHFVSLPSQIGRLRRLEHFSIAHNALAELPPEVGCLQELKFLDVRGNNLKKLPLEIWWANKLETLNASSNVMTDFPK

HMMSmart: SM00365
943-961 Leucine-rich repeat, SDS22-like subfam

LQSLRELDIKYNAISGIDV

HMMSmart: SM00369
IPR003591
943-964 Leucine-rich repeats, typical (most po
Leucine-rich repeat, typical subtype

LQSLRELDIKYNAISGIDVISL

ProfileScan: PS51450
IPR001611
945-966 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLRELDIKYNAISGIDVISLLP

HMMSmart: SM00369
IPR003591
965-987 Leucine-rich repeats, typical (most po
Leucine-rich repeat, typical subtype

LPKLEILAADHNAISQFVGSFER

ProfileScan: PS51450
IPR001611
967-988 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLEILAADHNAISQFVGSFERV

HMMSmart: SM00369
IPR003591
1007-1029 Leucine-rich repeats, typical (most po
Leucine-rich repeat, typical subtype

VPTLKLLNLSNAKLASIAESFNH

ProfileScan: PS51450
IPR001611
1009-1030 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

TLKLLNLSNAKLASIAESFNHM

Seg: seg
1010-1022 seg

LKLLNLSNAKLAS

HMMSmart: SM00364
1030-1049 Leucine-rich repeats, bacterial type

MLNLERLVLDRNHFVSLPSQ

HMMSmart: SM00369
IPR003591
1030-1052 Leucine-rich repeats, typical (most po
Leucine-rich repeat, typical subtype

MLNLERLVLDRNHFVSLPSQIGR

ProfileScan: PS51450
IPR001611
1032-1053 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLERLVLDRNHFVSLPSQIGRL

HMMSmart: SM00369
IPR003591
1053-1075 Leucine-rich repeats, typical (most po
Leucine-rich repeat, typical subtype

LRRLEHFSIAHNALAELPPEVGC

ProfileScan: PS51450
IPR001611
1055-1076 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RLEHFSIAHNALAELPPEVGCL

HMMSmart: SM00364
1076-1095 Leucine-rich repeats, bacterial type

LQELKFLDVRGNNLKKLPLE

HMMSmart: SM00369
IPR003591
1076-1099 Leucine-rich repeats, typical (most po
Leucine-rich repeat, typical subtype

LQELKFLDVRGNNLKKLPLEIWWA

HMMSmart: SM00365
1076-1096 Leucine-rich repeat, SDS22-like subfam

LQELKFLDVRGNNLKKLPLEI

ProfileScan: PS51450
IPR001611
1078-1099 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ELKFLDVRGNNLKKLPLEIWWA

HMMPfam: PF13504
1079-1093 LRR_7,Leucine rich repeat

LKFLDVRGNNLKKLP

HMMSmart: SM00364
1099-1118 Leucine-rich repeats, bacterial type

ANKLETLNASSNVMTDFPKP

ProfileScan: PS51450
IPR001611
1101-1122 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLETLNASSNVMTDFPKPASRP

Gene3D: G3DSA:3.80.10.10
1224-1408 no description

GLSARITNTFSGSLRNLFLADNLLDDDVFDQIMLLCELRVLNLSFNQISDMPQRCIKSWPQLSELYLSGNELTTIPVDDLEEYSLLQVLHINCNKFTNLPADISRAKKLAVLDCGSNFLKYNISNVPYDWNWNLNPNLRYLNLSGNRRLEIKQPAYGSGAGNREQYTDFSRLQNLRVLGLMDVTL

superfamily: SSF52058
1232-1415 L domain-like,LRR

TFSGSLRNLFLADNLLDDDVFDQIMLLCELRVLNLSFNQISDMPQRCIKSWPQLSELYLSGNELTTIPVDDLEEYSLLQVLHINCNKFTNLPADISRAKKLAVLDCGSNFLKYNISNVPYDWNWNLNPNLRYLNLSGNRRLEIKQPAYGSGAGNREQYTDFSRLQNLRVLGLMDVTLTQPSIPE

ProfileScan: PS51450
IPR001611
1236-1259 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLRNLFLADNLLDDDVFDQIMLLC

Seg: seg
1237-1253 seg

LRNLFLADNLLDDDVFD

HMMSmart: SM00364
1258-1277 Leucine-rich repeats, bacterial type

LCELRVLNLSFNQISDMPQR

HMMSmart: SM00369
IPR003591
1258-1281 Leucine-rich repeats, typical (most po
Leucine-rich repeat, typical subtype

LCELRVLNLSFNQISDMPQRCIKS

ProfileScan: PS51450
IPR001611
1260-1281 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ELRVLNLSFNQISDMPQRCIKS

HMMPfam: PF12799
1260-1299 LRR_4,Leucine Rich repeats (2 copies)

ELRVLNLSFNQISDMPQRCIKSWPQLSELYLSGNELTTIP

HMMSmart: SM00369
IPR003591
1282-1305 Leucine-rich repeats, typical (most po
Leucine-rich repeat, typical subtype

WPQLSELYLSGNELTTIPVDDLEE

HMMSmart: SM00364
1283-1301 Leucine-rich repeats, bacterial type

PQLSELYLSGNELTTIPVD

ProfileScan: PS51450
IPR001611
1284-1305 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLSELYLSGNELTTIPVDDLEE

HMMSmart: SM00364
1306-1325 Leucine-rich repeats, bacterial type

YSLLQVLHINCNKFTNLPAD

HMMSmart: SM00369
IPR003591
1306-1329 Leucine-rich repeats, typical (most po
Leucine-rich repeat, typical subtype

YSLLQVLHINCNKFTNLPADISRA

ProfileScan: PS51450
IPR001611
1308-1329 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

LLQVLHINCNKFTNLPADISRA

ProfileScan: PS51450
IPR001611
1360-1381 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLRYLNLSGNRRLEIKQPAYGS

HMMPfam: PF00560
IPR001611
1360-1373 LRR_1
Leucine-rich repeat

NLRYLNLSGNRRLE

Gene3D: G3DSA:3.60.40.10
IPR001932
1409-1709 no description
Protein phosphatase 2C-like

TQPSIPEQSEDCRVRTSGSSAGYLPYAMADTLGKNEHLSTVDLVVPRFNASETETLLGLFDGQALSSGGSKIAKYLHENFGQILATELRALKTGLKETPEDALRRAFLALNKELVTIAIQHSEDRPSVPHRSGSQAHVILNKEDLNSGGVATVVYLQGQDLYVANVGDAQAMIIQSDQTHKMLTRKHDPAEPTERSRIREAGGWVSRNGKLNDQLGVSRAFGYVDLMPAVQAAPHVSHVAIREQDEMILLATSELWEHLAPELIVDIARQERGDLMRATQKLRDLAIAYGSTNKIMIMMIS

superfamily: SSF81606
IPR001932
1412-1715 PP2C-like
Protein phosphatase 2C-like

SIPEQSEDCRVRTSGSSAGYLPYAMADTLGKNEHLSTVDLVVPRFNASETETLLGLFDGQALSSGGSKIAKYLHENFGQILATELRALKTGLKETPEDALRRAFLALNKELVTIAIQHSEDRPSVPHRSGSQAHVILNKEDLNSGGVATVVYLQGQDLYVANVGDAQAMIIQSDQTHKMLTRKHDPAEPTERSRIREAGGWVSRNGKLNDQLGVSRAFGYVDLMPAVQAAPHVSHVAIREQDEMILLATSELWEHLAPELIVDIARQERGDLMRATQKLRDLAIAYGSTNKIMIMMISVADLKR

HMMSmart: SM00332
IPR001932
1423-1708 Serine/threonine phosphatases, family
Protein phosphatase 2C-like

RTSGSSAGYLPYAMADTLGKNEHLSTVDLVVPRFNASETETLLGLFDGQALSSGGSKIAKYLHENFGQILATELRALKTGLKETPEDALRRAFLALNKELVTIAIQHSEDRPSVPHRSGSQAHVILNKEDLNSGGVATVVYLQGQDLYVANVGDAQAMIIQSDQTHKMLTRKHDPAEPTERSRIREAGGWVSRNGKLNDQLGVSRAFGYVDLMPAVQAAPHVSHVAIREQDEMILLATSELWEHLAPELIVDIARQERGDLMRATQKLRDLAIAYGSTNKIMIMMI

HMMPfam: PF00481
IPR001932
1451-1703 PP2C
Protein phosphatase 2C-like

LVVPRFNASETETLLGLFDGQALSSGGSKIAKYLHENFGQILATELRALKTGLKETPEDALRRAFLALNKELVTIAIQHSEDRPSVPHRSGSQAHVILNKEDLNSGGVATVVYLQGQDLYVANVGDAQAMIIQSDQTHKMLTRKHDPAEPTERSRIREAGGWVSRNGKLNDQLGVSRAFGYVDLMPAVQAAPHVSHVAIREQDEMILLATSELWEHLAPELIVDIARQERGDLMRATQKLRDLAIAYGSTNKI

HMMSmart: SM00044
IPR001054
1655-1939 Adenylyl- / guanylyl cyclase, catalyti
Adenylyl cyclase class-3/4/guanylyl cyclase

MILLATSELWEHLAPELIVDIARQERGDLMRATQKLRDLAIAYGSTNKIMIMMISVADLKRRTERTRINRGQSMSIHNLSLHGEQYKFPTRGRRKKDQVMDSTLQRLEAEVPAPTGMIAIVFTDIKNSTNLWETYPAAMRSAIRLHNEMMRRQLRRIGGFEVKTEGDAFMVSFPTATSALLWCFAVQLQLLEVNWPSEMLNSLSCKPTVDKNNQVIFKGLSVRMGIHWGEPLCEPDPITRRMDYYGPMVNKASRISAVADGGQITVSSDFISEIQRCLETYQGAN

superfamily: SSF55073
IPR001054
1760-2010 Nucleotide cyclase
Adenylyl cyclase class-3/4/guanylyl cyclase

RLEAEVPAPTGMIAIVFTDIKNSTNLWETYPAAMRSAIRLHNEMMRRQLRRIGGFEVKTEGDAFMVSFPTATSALLWCFAVQLQLLEVNWPSEMLNSLSCKPTVDKNNQVIFKGLSVRMGIHWGEPLCEPDPITRRMDYYGPMVNKASRISAVADGGQITVSSDFISEIQRCLETYQGANAAALVNESFDEDPFSMAIRKELRSLSSQGFEVKELGERKLKGLENPEVVYSLYPHQLAGRIETHQAHDKGV

HMMPfam: PF00211
IPR001054
1768-1928 Guanylate_cyc
Adenylyl cyclase class-3/4/guanylyl cyclase

PTGMIAIVFTDIKNSTNLWETYPAAMRSAIRLHNEMMRRQLRRIGGFEVKTEGDAFMVSFPTATSALLWCFAVQLQLLEVNWPSEMLNSLSCKPTVDKNNQVIFKGLSVRMGIHWGEPLCEPDPITRRMDYYGPMVNKASRISAVADGGQITVSSDFISEI

ProfileScan: PS50125
IPR001054
1773-1910 GUANYLATE_CYCLASE_2
Adenylyl cyclase class-3/4/guanylyl cyclase

AIVFTDIKNSTNLWETYPAAMRSAIRLHNEMMRRQLRRIGGFEVKTEGDAFMVSFPTATSALLWCFAVQLQLLEVNWPSEMLNSLSCKPTVDKNNQVIFKGLSVRMGIHWGEPLCEPDPITRRMDYYGPMVNKASRIS

Gene3D: G3DSA:3.30.70.1230
IPR001054
1965-2004 no description
Adenylyl cyclase class-3/4/guanylyl cyclase

SSQGFEVKELGERKLKGLENPEVVYSLYPHQLAGRIETHQ

ProfileScan: PS51450
IPR001611
2105-2126 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SIRHLNMGGGTIKELDDLRGPI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox