PRGDB00071120 (Mgr.13454)

From PRG Wiki
Jump to: navigation, search
Mgr.13454
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 171188412 (EU545466)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Magnaporthe grisea

Comment?

Magnaporthe grisea calcium

DNA Sequence

ATGAGCTTCTCTGGTATGCTCAACCGCCTGCATGGCCAGCCAGAGAGTTACGACAAGAAATCAAAATATCGATTCGGCAAAACCCTTGGAGCTGGCACATATGGCATCGTCAGAGAAGCGGAGGGACAGACCGGCAAGGTTGCCATCAAGATCATTCTGAAGAAGAATGTCAAGGGCAACGAACGCATGGTGTACGATGAGCTCGAAATGCTCCAGCGACTTCAGCATCCGCACATCGTCCGGTTCGTGGACTGGTTTGAGTCGAGAGACAAGTACTACATTGTGACCGAACTGGCGACTGGAGGCGAGCTTTTCGACCGTATTTGCGAGCAGGGCAAGTTCACTGAAAAGGATGCCTCGCAAACTATCAAACAGGTTCTTGGTGCCGTAGACTACCTACACAGCAAGAACGTTGTCCACAGAGATCTCAAACCCGAGAACCTACTTTACCTGAGCAAAGCGCCCGATTCGGATCTGGTCCTGGCAGACTTTGGTATCGCCAAGATGCTAGACAGCAGGGACGAGGTCCTCACAACCATGGCTGGCTCCTTTGGGTATGCAGCTCCTGAGGTCATGATGAAGAAGGGACATGGAAAGCCAGTCGACATGTGGTCCATGGGTGTCATCACGTACACACTACTCTGCGGTTATTCTCCGTTCCGATCTGAGGGCCTTCAGGACCTTATCGAGGAATGCTCCAATGCACAGGTGACATTCCATGACAGGTATTGGCGAGACGTCAGCGAGGACGCAAAGAACTTTATCAGGTCTCTGCTACAGGCCAACCCAGACGATCGCGCGACCAGCGGTCAAGCTCTCCGACACCCGTGGCTCAGCGGTGAGAACGCAACGGACCACAACTTGCTGCCCGAAATCAAGTCCTTCATGGCAAAGGCCCGACTTCGACGTGGCATCGAGATGGTCAAGCTGGCGAACCGCATCCAGACGCTCAAGCTACAGGAAGAAGACCCTGACAACACAGACATGCCGGACGACGCGGTCGAGGCGGCAGACGATTCACAGGGCAATGCAGGATCATCTGGAGGCAGCGGACTGTTCAAGCCAGGGGAGAAGAAGACCATGTCAAAGGCGGTGAAGGGCGCAATCTTCCGCGAGGTGGTGCTGGCCAAAGTCAGGGAGATGAAGACGCAAGAGGAGACGCTCAAGGTGGCGGAGGAGGTAGAGAAGGAGGCTCGCAGGAAGAGCTTCACTGGCTCATGA


Protein sequences

Name Description Sequence
Mgr.13454 translated coding region predicted by ESTScan from UniGene Mgr.13454

MSFSGMLNRLHGQPESYDKKSKYRFGKTLGAGTYGIVREAEGQTGKVAIKIILKKNVKGNERMVYDELEMLQRLQHPHIVRFVDWFESRDKYYIVTELATGGELFDRICEQGKFTEKDASQTIKQVLGAVDYLHSKNVVHRDLKPENLLYLSKAPDSDLVLADFGIAKMLDSRDEVLTTMAGSFGYAAPEVMMKKGHGKPVDMWSMGVITYTLLCGYSPFRSEGLQDLIEECSNAQVTFHDRYWRDVSEDAKNFIRSLLQANPDDRATSGQALRHPWLSGENATDHNLLPEIKSFMAKARLRRGIEMVKLANRIQTLKLQEEDPDNTDMPDDAVEAADDSQGNAGSSGGSGLFKPGEKKTMSKAVKGAIFREVVLAKVREMKTQEETLKVAEEVEKEARRKSFTGS

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
5-338 Protein kinase-like (PK-like)
Protein kinase-like domain

GMLNRLHGQPESYDKKSKYRFGKTLGAGTYGIVREAEGQTGKVAIKIILKKNVKGNERMVYDELEMLQRLQHPHIVRFVDWFESRDKYYIVTELATGGELFDRICEQGKFTEKDASQTIKQVLGAVDYLHSKNVVHRDLKPENLLYLSKAPDSDLVLADFGIAKMLDSRDEVLTTMAGSFGYAAPEVMMKKGHGKPVDMWSMGVITYTLLCGYSPFRSEGLQDLIEECSNAQVTFHDRYWRDVSEDAKNFIRSLLQANPDDRATSGQALRHPWLSGENATDHNLLPEIKSFMAKARLRRGIEMVKLANRIQTLKLQEEDPDNTDMPDDAVEAAD

Gene3D: G3DSA:3.30.200.20
16-115 no description

SYDKKSKYRFGKTLGAGTYGIVREAEGQTGKVAIKIILKKNVKGNERMVYDELEMLQRLQHPHIVRFVDWFESRDKYYIVTELATGGELFDRICEQGKFT

HMMPanther: PTHR24347:SF29
22-318 SUBFAMILY NOT NAMED

KYRFGKTLGAGTYGIVREAEGQTGKVAIKIILKKNVKGNERMVYDELEMLQRLQHPHIVRFVDWFESRDKYYIVTELATGGELFDRICEQGKFTEKDASQTIKQVLGAVDYLHSKNVVHRDLKPENLLYLSKAPDSDLVLADFGIAKMLDSRDEVLTTMAGSFGYAAPEVMMKKGHGKPVDMWSMGVITYTLLCGYSPFRSEGLQDLIEECSNAQVTFHDRYWRDVSEDAKNFIRSLLQANPDDRATSGQALRHPWLSGENATDHNLLPEIKSFMAKARLRRGIEMVKLANRIQTLK

HMMPanther: PTHR24347
IPR020636
22-318 FAMILY NOT NAMED
Calcium/calmodulin-dependent protein kinase-like

KYRFGKTLGAGTYGIVREAEGQTGKVAIKIILKKNVKGNERMVYDELEMLQRLQHPHIVRFVDWFESRDKYYIVTELATGGELFDRICEQGKFTEKDASQTIKQVLGAVDYLHSKNVVHRDLKPENLLYLSKAPDSDLVLADFGIAKMLDSRDEVLTTMAGSFGYAAPEVMMKKGHGKPVDMWSMGVITYTLLCGYSPFRSEGLQDLIEECSNAQVTFHDRYWRDVSEDAKNFIRSLLQANPDDRATSGQALRHPWLSGENATDHNLLPEIKSFMAKARLRRGIEMVKLANRIQTLK

HMMPfam: PF00069
IPR017442
23-278 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

YRFGKTLGAGTYGIVREAEGQTGKVAIKIILKKNVKGNERMVYDELEMLQRLQHPHIVRFVDWFESRDKYYIVTELATGGELFDRICEQGKFTEKDASQTIKQVLGAVDYLHSKNVVHRDLKPENLLYLSKAPDSDLVLADFGIAKMLDSRDEVLTTMAGSFGYAAPEVMMKKGHGKPVDMWSMGVITYTLLCGYSPFRSEGLQDLIEECSNAQVTFHDRYWRDVSEDAKNFIRSLLQANPDDRATSGQALRHPWL

ProfileScan: PS50011
IPR000719
23-278 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YRFGKTLGAGTYGIVREAEGQTGKVAIKIILKKNVKGNERMVYDELEMLQRLQHPHIVRFVDWFESRDKYYIVTELATGGELFDRICEQGKFTEKDASQTIKQVLGAVDYLHSKNVVHRDLKPENLLYLSKAPDSDLVLADFGIAKMLDSRDEVLTTMAGSFGYAAPEVMMKKGHGKPVDMWSMGVITYTLLCGYSPFRSEGLQDLIEECSNAQVTFHDRYWRDVSEDAKNFIRSLLQANPDDRATSGQALRHPWL

HMMSmart: SM00220
IPR002290
23-278 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YRFGKTLGAGTYGIVREAEGQTGKVAIKIILKKNVKGNERMVYDELEMLQRLQHPHIVRFVDWFESRDKYYIVTELATGGELFDRICEQGKFTEKDASQTIKQVLGAVDYLHSKNVVHRDLKPENLLYLSKAPDSDLVLADFGIAKMLDSRDEVLTTMAGSFGYAAPEVMMKKGHGKPVDMWSMGVITYTLLCGYSPFRSEGLQDLIEECSNAQVTFHDRYWRDVSEDAKNFIRSLLQANPDDRATSGQALRHPWL

HMMSmart: SM00219
IPR020635
23-278 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

YRFGKTLGAGTYGIVREAEGQTGKVAIKIILKKNVKGNERMVYDELEMLQRLQHPHIVRFVDWFESRDKYYIVTELATGGELFDRICEQGKFTEKDASQTIKQVLGAVDYLHSKNVVHRDLKPENLLYLSKAPDSDLVLADFGIAKMLDSRDEVLTTMAGSFGYAAPEVMMKKGHGKPVDMWSMGVITYTLLCGYSPFRSEGLQDLIEECSNAQVTFHDRYWRDVSEDAKNFIRSLLQANPDDRATSGQALRHPWL

PatternScan: PS00107
IPR017441
29-54 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGAGTYGIVREAEGQTGKVAIKIILK

Gene3D: G3DSA:1.10.510.10
116-322 no description

EKDASQTIKQVLGAVDYLHSKNVVHRDLKPENLLYLSKAPDSDLVLADFGIAKMLDSRDEVLTTMAGSFGYAAPEVMMKKGHGKPVDMWSMGVITYTLLCGYSPFRSEGLQDLIEECSNAQVTFHDRYWRDVSEDAKNFIRSLLQANPDDRATSGQALRHPWLSGENATDHNLLPEIKSFMAKARLRRGIEMVKLANRIQTLKLQEE

PatternScan: PS00108
IPR008271
138-150 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VVHRDLKPENLLY

Seg: seg
345-351 seg

GSSGGSG

Coil: coil
381-402 coiled-coil

MKTQEETLKVAEEVEKEARRKS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox