PRGDB00071121 (Mgr.15582)

From PRG Wiki
Jump to: navigation, search
Mgr.15582
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 30394240 (BM866977)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Magnaporthe grisea

Comment?

mgcs008xD11f.b Magnaporthe grisea CS Uni-Zap XR Library Magnaporthe grisea cDNA clone mgcs008xD11 5', mRNA sequence

DNA Sequence

CACCCCAATATTGTGCAGTACCTCGGCTGTGGCTCTTCTGCTGAATACCTCAACATTTTTCTCGAGTATGTCCCTGGTGGCTCGGTCCAGACCATGCTCAACTCCTATGGCGCATTGCCAGAGCCTCTGGTCCGCAGTTTTGTGAGACAAATTCTGAACGGTTTGTCGTATCTCCACGAACGTGAGATCATCCACCGAGACATCAAGGGTGCCAACATCCTTGTGGATAACAAGGGCACCATCAAGATCTCGGACTTTGGTATTTCAAAGAAGATCGAGGCCACCAACCTCCTCAACGGCGCCAACAACAACAAACACCGGCCCTCGCTGCAGGGTTCGGTGTTTTGGATGGCCCCCGAGGTTGTCAAGCAGACAAGTTATACCCGCAAGGCCGACATCTGGTCACTTGGCTGCCTGGTCGTCGAAATGATGACGGCTACACACCCATTCCCGGACTGCACACAGTTGCAGGCCATCTTCAAGATCGGGGGAGGCAAGGTACCGCTCAACATTCCCGAGGATGCGAGCCCAGAGGCCATGGCTTTTCTGGCCCACACTTTTGA


Protein sequences

Name Description Sequence
Mgr.15582 translated coding region predicted by ESTScan from UniGene Mgr.15582

HPNIVQYLGCGSSAEYLNIFLEYVPGGSVQTMLNSYGALPEPLVRSFVRQILNGLSYLHEREIIHRDIKGANILVDNKGTIKISDFGISKKIEATNLLNGANNNKHRPSLQGSVFWMAPEVVKQTSYTRKADIWSLGCLVVEMMTATHPFPDCTQLQAIFKIGGGKVPLNIPEDASPEAMAFLAHTFX

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
1-185 Protein kinase-like (PK-like)
Protein kinase-like domain

HPNIVQYLGCGSSAEYLNIFLEYVPGGSVQTMLNSYGALPEPLVRSFVRQILNGLSYLHEREIIHRDIKGANILVDNKGTIKISDFGISKKIEATNLLNGANNNKHRPSLQGSVFWMAPEVVKQTSYTRKADIWSLGCLVVEMMTATHPFPDCTQLQAIFKIGGGKVPLNIPEDASPEAMAFLAH

ProfileScan: PS50011
IPR000719
1-188 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

HPNIVQYLGCGSSAEYLNIFLEYVPGGSVQTMLNSYGALPEPLVRSFVRQILNGLSYLHEREIIHRDIKGANILVDNKGTIKISDFGISKKIEATNLLNGANNNKHRPSLQGSVFWMAPEVVKQTSYTRKADIWSLGCLVVEMMTATHPFPDCTQLQAIFKIGGGKVPLNIPEDASPEAMAFLAHTFX

Gene3D: G3DSA:3.30.200.20
1-52 no description

HPNIVQYLGCGSSAEYLNIFLEYVPGGSVQTMLNSYGALPEPLVRSFVRQIL

HMMPanther: PTHR24361:SF64
1-187 SUBFAMILY NOT NAMED

HPNIVQYLGCGSSAEYLNIFLEYVPGGSVQTMLNSYGALPEPLVRSFVRQILNGLSYLHEREIIHRDIKGANILVDNKGTIKISDFGISKKIEATNLLNGANNNKHRPSLQGSVFWMAPEVVKQTSYTRKADIWSLGCLVVEMMTATHPFPDCTQLQAIFKIGGGKVPLNIPEDASPEAMAFLAHTF

HMMPanther: PTHR24361
1-187 FAMILY NOT NAMED,MITOGEN-ACTIVATED KINASE KINASE KINASE

HPNIVQYLGCGSSAEYLNIFLEYVPGGSVQTMLNSYGALPEPLVRSFVRQILNGLSYLHEREIIHRDIKGANILVDNKGTIKISDFGISKKIEATNLLNGANNNKHRPSLQGSVFWMAPEVVKQTSYTRKADIWSLGCLVVEMMTATHPFPDCTQLQAIFKIGGGKVPLNIPEDASPEAMAFLAHTF

HMMPfam: PF00069
IPR017442
1-183 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

HPNIVQYLGCGSSAEYLNIFLEYVPGGSVQTMLNSYGALPEPLVRSFVRQILNGLSYLHEREIIHRDIKGANILVDNKGTIKISDFGISKKIEATNLLNGANNNKHRPSLQGSVFWMAPEVVKQTSYTRKADIWSLGCLVVEMMTATHPFPDCTQLQAIFKIGGGKVPLNIPEDASPEAMAFL

HMMSmart: SM00220
IPR002290
1-188 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

HPNIVQYLGCGSSAEYLNIFLEYVPGGSVQTMLNSYGALPEPLVRSFVRQILNGLSYLHEREIIHRDIKGANILVDNKGTIKISDFGISKKIEATNLLNGANNNKHRPSLQGSVFWMAPEVVKQTSYTRKADIWSLGCLVVEMMTATHPFPDCTQLQAIFKIGGGKVPLNIPEDASPEAMAFLAHTFX

HMMSmart: SM00219
IPR020635
1-187 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

HPNIVQYLGCGSSAEYLNIFLEYVPGGSVQTMLNSYGALPEPLVRSFVRQILNGLSYLHEREIIHRDIKGANILVDNKGTIKISDFGISKKIEATNLLNGANNNKHRPSLQGSVFWMAPEVVKQTSYTRKADIWSLGCLVVEMMTATHPFPDCTQLQAIFKIGGGKVPLNIPEDASPEAMAFLAHTF

FPrintScan: PR00109
IPR001245
21-34 TYRKINASE
Serine-threonine/tyrosine-protein kinase

LEYVPGGSVQTMLN

Gene3D: G3DSA:1.10.510.10
53-184 no description

NGLSYLHEREIIHRDIKGANILVDNKGTIKISDFGISKKIEATNLLNGANNNKHRPSLQGSVFWMAPEVVKQTSYTRKADIWSLGCLVVEMMTATHPFPDCTQLQAIFKIGGGKVPLNIPEDASPEAMAFLA

FPrintScan: PR00109
IPR001245
57-75 TYRKINASE
Serine-threonine/tyrosine-protein kinase

YLHEREIIHRDIKGANILV

PatternScan: PS00108
IPR008271
63-75 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDIKGANILV

FPrintScan: PR00109
IPR001245
112-122 TYRKINASE
Serine-threonine/tyrosine-protein kinase

GSVFWMAPEVV

FPrintScan: PR00109
IPR001245
131-153 TYRKINASE
Serine-threonine/tyrosine-protein kinase

ADIWSLGCLVVEMMTATHPFPDC






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox