PRGDB00071122 (Mgr.15621)

From PRG Wiki
Jump to: navigation, search
Mgr.15621
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145613529 (XM_363637)
Gene Class N
Domain Type NBS
Gene Species Magnaporthe grisea

Comment?

Magnaporthe grisea 70-15 hypothetical protein (MGG_01563) partial mRNA

DNA Sequence

ATGGATGATAGGCCAAAGGATTGCCCGCCATGCTTCAACTGTCTGCTTCCGGCTTACACGTGCGGGCAATACGGCGGCTGTAACGAATACGATGGCACCTGCCGATGCCCCGAAGGCTACGGTGGTTTGGACTGCATGGAGCCTCTCTGCGGATCTCTTGCGCGCGGCAAAGATCGACCTATGAGGAGCGGCGACCAGTGCTCCTGTGACGAGGGATGGACGGGTATAAACTGCAACGTTTGCACCGAAAACAAGTACTGCGATGCTCTCATGCCAGAGAATGAAGGCGGAGTATGCTATCAAATGGGCGACGTCGTCAACCATAACTACCAGATGTGCGATGTCACCAACAAGCCAATTCTTGACATGCTCGGCGGCCGCAAGCCTCAGGTCACCTTTGATTGCGACAAGGCATCTGGCGAGTGCGACTTTCAATTCTGGATTGACCAAAAGGAGTCCTTCTACTGCCACTTGAACAAGTGCGATGCATCTGCCGAGTTTGACGAGTCGCGAAACAGCACGAATTATGACTGCGGCAAGGTCAACTGCAGCTGCATTCCTGGGCGATTTCTCTGTGGCGAATCGGGGTCTGTTGATATCGGCGATTTCTTGGATCAAGAGATCAAGGGTCCGGCAACTTTCAAGTGCCTGCAAAAAACCGGAGATAAGAACAACTGCGACTTTGACGAGGCTGCAATGAACGACCTGGTTAGCAGTATCTTTGGCGACAAGACCATCACACTCTCCTGTCGGTCTGGAGAGTGTCTCTATCACACGCAGGTTCCAGGATACAAGCGGCCCGTTTCCAAGATCAACACCCCTCTCATCGCAGGCGTCATCGCCATGTGCTCGATCTTCGTGGCGGTAACCATTATAATTATTTGGTACCTGTCTCGACGCAAGTTTAGATACGGCCCAATCCACTTGGATGATTCGGACGACGAACAAGTGAAGCTCATGGCTGACCACAAGCCTGCTTCCCTTTATTTTGAGAATGTCTGTTATGGCCTCAACGGTCGGCAAATTCTCTCTGAGATCCAGGGAATGGCACATCCTGGAGAGATAACTGCCATTATGGGAGCCTCGGGTGCCGGGAAGACAACTTTCCTTGACATCCTCGCCCGCAAAAACAAAAGGGGTGTCGTTGGCGGCGATTTCTTTGTCAATGGAGAAAAGGTCAATGATACAGACTACAAGAATGTTGTCGGTTTCGTTGATCAGGAAGACACCATGCTGCCAACTCTTACTGTTCATGAAACGATCCTGAACAGCGCTCTCCTGCGCCTTCCGAGGGAGATGAGCCGCCAGGCAAAGGAACAGCGCGTCTACGAGGTTGAGAAGCAACTTGGCATCTACCACATTCGTGATTCGCTGATTGGATCTGAAGAAGGCAAGGGGCGCGGTATCTCTGGCGGAGAGAAGAGAAGAGTAGGCATCGCCTGCGAGCTTGTCACGAGTCCATCAATTCTCTTCCTCGACGAGCCCACTAGTGGCCTCGATGCCTACAACGCCTATAATGTCATTGAGTGCCTGGTAAACCTGGCCAAGACATACAAGCGAACCGTCATATTTACAATTCACCAACCCAGATCCAACATCGTAGCTCTGTTTGATCGCCTGATCCTTCTTGCTCAGGGGAAAACAGTCTACTCCGGCCCATTCCATCAGTGTCAAGACTACTTTGACCGCATTGGCTACGCCTGCCCACCGGGCTTCAACATTGCCGACTATTTGGTTGATCTCACCATGCATGCAGGCACGACCACTTCTTTTGATGATGGCTCCATCTCTGCAGACGTGGCAAGTGTTGGGCCTAGCAGCACCCGCGCGGTCAAATCAATCGCCAGCATCTCTGGTGGCAGCATTGGTGAAGACAGTGGCGCCGAAGGCTCCTCATCCACGAGGCCGAAGAACAAGCGTCGAGACTCGGTGAAGACACGCCAGGAAAGGGAACTTTTTACCAGGCGCAAGAACACTGTCGATACGGCCGCTTCCTCTGATGCCGGTGAGGAGATTGGGGCTTACAGACTTCAAAAGCAACCCCACAATACCGAGGCCTCACAACTGACTGCAGACGATCCGCATGACCTTCCGCCGGCTGCGTTGAGCGGAACAGATCTGGACATGCTGGTAAACTCCTTCCAGCAGTCAGACATAGCTGGGAACACGCATGACGAAATTCACCAGGCAATTGCTGGTGCCCGGAGCGCCAATGGATCCAACTCGAATGGCTATAGTACAGCTGGTCCAAACATCCACACTAGCGTCATGGGGAGAGGGTATGCTCGTGTCAGCTACGCCCGCCAGTTTGTTATTTTGTCACGAAGGACCTGGATCAATCTCTACCGCAACCCGATGTTGATGCTCATGCATTACGCCATGGCGATTCTCCTTGGAGTTCTGTCTGGATTCCTGTTTTACGGCCTGACTAGCGACATTGCCGGTTTCCAGAACAGATTGGGTCTTTTCTTCTTCATCCTTGCACTTTTTGGATTTAGTACCCTGACGAGCCTGGCGGTTTTCTCCTCTGAACGGCTTCTGTTTGTCAAGGAAAGGGCCAACGGCTATTACTCTCCGATAACCTACTTCGCGGCCAAGGTCATCTTCGACATTATTCCCCTTAGAATCATCCCGCCGATCCTGATGGGTTCCATCATCTATCCGATGACTGGACTGGTGCCCGATGCTCCTCATTACTTCACTTTCATTACTGTTCTGGTCCTTTTCAACCTCGCCGCAGCGGCTATATGCCTTTTCCTAGGAATAGTTTGCAAAGATGGCAGTGTCGCGAACCTTCTTGGCAGTCTGGTCATGCTGTTCAGCTTGCTGTTTGCCGGCCTTTTGCTTAACCAGAATGCGATTCCGGATCCTGCAAAGTGGCTGCAATCGCTCTCGATATTCCATTACGGCTTCGAGTCACTGATTGTTAACGAAGTCAGCCATTTGCAACTGATAGACAACAAGTATGGCTTAGATATCACCGTACCGGGTGCCAGCATTCTCTCATCCTTCGGGTTTAACAACAATGCCCTGTGGCCGGATGTTATCAACCTCGGCATTTTTGGCGTTATGTTCATTATTTTGGCGTACCTTGCCATGCACTTCCTCCTGGTGGAGAGGCGTTAA


Protein sequences

Name Description Sequence
Mgr.15621 translated coding region predicted by ESTScan from UniGene Mgr.15621

MDDRPKDCPPCFNCLLPAYTCGQYGGCNEYDGTCRCPEGYGGLDCMEPLCGSLARGKDRPMRSGDQCSCDEGWTGINCNVCTENKYCDALMPENEGGVCYQMGDVVNHNYQMCDVTNKPILDMLGGRKPQVTFDCDKASGECDFQFWIDQKESFYCHLNKCDASAEFDESRNSTNYDCGKVNCSCIPGRFLCGESGSVDIGDFLDQEIKGPATFKCLQKTGDKNNCDFDEAAMNDLVSSIFGDKTITLSCRSGECLYHTQVPGYKRPVSKINTPLIAGVIAMCSIFVAVTIIIIWYLSRRKFRYGPIHLDDSDDEQVKLMADHKPASLYFENVCYGLNGRQILSEIQGMAHPGEITAIMGASGAGKTTFLDILARKNKRGVVGGDFFVNGEKVNDTDYKNVVGFVDQEDTMLPTLTVHETILNSALLRLPREMSRQAKEQRVYEVEKQLGIYHIRDSLIGSEEGKGRGISGGEKRRVGIACELVTSPSILFLDEPTSGLDAYNAYNVIECLVNLAKTYKRTVIFTIHQPRSNIVALFDRLILLAQGKTVYSGPFHQCQDYFDRIGYACPPGFNIADYLVDLTMHAGTTTSFDDGSISADVASVGPSSTRAVKSIASISGGSIGEDSGAEGSSSTRPKNKRRDSVKTRQERELFTRRKNTVDTAASSDAGEEIGAYRLQKQPHNTEASQLTADDPHDLPPAALSGTDLDMLVNSFQQSDIAGNTHDEIHQAIAGARSANGSNSNGYSTAGPNIHTSVMGRGYARVSYARQFVILSRRTWINLYRNPMLMLMHYAMAILLGVLSGFLFYGLTSDIAGFQNRLGLFFFILALFGFSTLTSLAVFSSERLLFVKERANGYYSPITYFAAKVIFDIIPLRIIPPILMGSIIYPMTGLVPDAPHYFTFITVLVLFNLAAAAICLFLGIVCKDGSVANLLGSLVMLFSLLFAGLLLNQNAIPDPAKWLQSLSIFHYGFESLIVNEVSHLQLIDNKYGLDITVPGASILSSFGFNNNALWPDVINLGIFGVMFIILAYLAMHFLLVERR

Domains

Domain Start-End Description Sequence

PatternScan: PS00022
IPR013032
34-45 EGF_1
EGF-like region, conserved site

CRCPEGYGGLDC

ProfileScan: PS50026
IPR000742
41-79 EGF_3
Epidermal growth factor-like, type 3

GGLDCMEPLCGSLARGKDRPMRSGDQCSCDEGWTGINCN

PatternScan: PS00022
IPR013032
67-78 EGF_1
EGF-like region, conserved site

CSCDEGWTGINC

HMMPanther: PTHR19241:SF24
298-1041 ATP-DEPENDENT PERMEASE,ATP-DEPENDENT PERMEASE

SRRKFRYGPIHLDDSDDEQVKLMADHKPASLYFENVCYGLNGRQILSEIQGMAHPGEITAIMGASGAGKTTFLDILARKNKRGVVGGDFFVNGEKVNDTDYKNVVGFVDQEDTMLPTLTVHETILNSALLRLPREMSRQAKEQRVYEVEKQLGIYHIRDSLIGSEEGKGRGISGGEKRRVGIACELVTSPSILFLDEPTSGLDAYNAYNVIECLVNLAKTYKRTVIFTIHQPRSNIVALFDRLILLAQGKTVYSGPFHQCQDYFDRIGYACPPGFNIADYLVDLTMHAGTTTSFDDGSISADVASVGPSSTRAVKSIASISGGSIGEDSGAEGSSSTRPKNKRRDSVKTRQERELFTRRKNTVDTAASSDAGEEIGAYRLQKQPHNTEASQLTADDPHDLPPAALSGTDLDMLVNSFQQSDIAGNTHDEIHQAIAGARSANGSNSNGYSTAGPNIHTSVMGRGYARVSYARQFVILSRRTWINLYRNPMLMLMHYAMAILLGVLSGFLFYGLTSDIAGFQNRLGLFFFILALFGFSTLTSLAVFSSERLLFVKERANGYYSPITYFAAKVIFDIIPLRIIPPILMGSIIYPMTGLVPDAPHYFTFITVLVLFNLAAAAICLFLGIVCKDGSVANLLGSLVMLFSLLFAGLLLNQNAIPDPAKWLQSLSIFHYGFESLIVNEVSHLQLIDNKYGLDITVPGASILSSFGFNNNALWPDVINLGIFGVMFIILAYLAMHFLLVERR

HMMPanther: PTHR19241
298-1041 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

SRRKFRYGPIHLDDSDDEQVKLMADHKPASLYFENVCYGLNGRQILSEIQGMAHPGEITAIMGASGAGKTTFLDILARKNKRGVVGGDFFVNGEKVNDTDYKNVVGFVDQEDTMLPTLTVHETILNSALLRLPREMSRQAKEQRVYEVEKQLGIYHIRDSLIGSEEGKGRGISGGEKRRVGIACELVTSPSILFLDEPTSGLDAYNAYNVIECLVNLAKTYKRTVIFTIHQPRSNIVALFDRLILLAQGKTVYSGPFHQCQDYFDRIGYACPPGFNIADYLVDLTMHAGTTTSFDDGSISADVASVGPSSTRAVKSIASISGGSIGEDSGAEGSSSTRPKNKRRDSVKTRQERELFTRRKNTVDTAASSDAGEEIGAYRLQKQPHNTEASQLTADDPHDLPPAALSGTDLDMLVNSFQQSDIAGNTHDEIHQAIAGARSANGSNSNGYSTAGPNIHTSVMGRGYARVSYARQFVILSRRTWINLYRNPMLMLMHYAMAILLGVLSGFLFYGLTSDIAGFQNRLGLFFFILALFGFSTLTSLAVFSSERLLFVKERANGYYSPITYFAAKVIFDIIPLRIIPPILMGSIIYPMTGLVPDAPHYFTFITVLVLFNLAAAAICLFLGIVCKDGSVANLLGSLVMLFSLLFAGLLLNQNAIPDPAKWLQSLSIFHYGFESLIVNEVSHLQLIDNKYGLDITVPGASILSSFGFNNNALWPDVINLGIFGVMFIILAYLAMHFLLVERR

Gene3D: G3DSA:3.40.50.300
326-559 no description

ASLYFENVCYGLNGRQILSEIQGMAHPGEITAIMGASGAGKTTFLDILARKNKRGVVGGDFFVNGEKVNDTDYKNVVGFVDQEDTMLPTLTVHETILNSALLRLPREMSRQAKEQRVYEVEKQLGIYHIRDSLIGSEEGKGRGISGGEKRRVGIACELVTSPSILFLDEPTSGLDAYNAYNVIECLVNLAKTYKRTVIFTIHQPRSNIVALFDRLILLAQGKTVYSGPFHQCQD

ProfileScan: PS50893
IPR003439
328-570 ABC_TRANSPORTER_2
ABC transporter-like

LYFENVCYGLNGRQILSEIQGMAHPGEITAIMGASGAGKTTFLDILARKNKRGVVGGDFFVNGEKVNDTDYKNVVGFVDQEDTMLPTLTVHETILNSALLRLPREMSRQAKEQRVYEVEKQLGIYHIRDSLIGSEEGKGRGISGGEKRRVGIACELVTSPSILFLDEPTSGLDAYNAYNVIECLVNLAKTYKRTVIFTIHQPRSNIVALFDRLILLAQGKTVYSGPFHQCQDYFDRIGYACPP

superfamily: SSF52540
328-574 P-loop containing nucleoside triphosphate hydrolases

LYFENVCYGLNGRQILSEIQGMAHPGEITAIMGASGAGKTTFLDILARKNKRGVVGGDFFVNGEKVNDTDYKNVVGFVDQEDTMLPTLTVHETILNSALLRLPREMSRQAKEQRVYEVEKQLGIYHIRDSLIGSEEGKGRGISGGEKRRVGIACELVTSPSILFLDEPTSGLDAYNAYNVIECLVNLAKTYKRTVIFTIHQPRSNIVALFDRLILLAQGKTVYSGPFHQCQDYFDRIGYACPPGFNI

HMMSmart: SM00382
IPR003593
352-547 ATPases associated with a variety of cellula,NBS
AAA+ ATPase domain

PGEITAIMGASGAGKTTFLDILARKNKRGVVGGDFFVNGEKVNDTDYKNVVGFVDQEDTMLPTLTVHETILNSALLRLPREMSRQAKEQRVYEVEKQLGIYHIRDSLIGSEEGKGRGISGGEKRRVGIACELVTSPSILFLDEPTSGLDAYNAYNVIECLVNLAKTYKRTVIFTIHQPRSNIVALFDRLILLAQGK

HMMPfam: PF00005
IPR003439
368-497 ABC_tran
ABC transporter-like

TFLDILARKNKRGVVGGDFFVNGEKVNDTDYKNVVGFVDQEDTMLPTLTVHETILNSALLRLPREMSRQAKEQRVYEVEKQLGIYHIRDSLIGSEEGKGRGISGGEKRRVGIACELVTSPSILFLDEPTS

PatternScan: PS00211
IPR017871
469-483 ABC_TRANSPORTER_1
ABC transporter, conserved site

ISGGEKRRVGIACEL

Seg: seg
613-633 seg

SIASISGGSIGEDSGAEGSSS

HMMPfam: PF01061
IPR013525
768-978 ABC2_membrane
ABC-2 type transporter

RQFVILSRRTWINLYRNPMLMLMHYAMAILLGVLSGFLFYGLTSDIAGFQNRLGLFFFILALFGFSTLTSLAVFSSERLLFVKERANGYYSPITYFAAKVIFDIIPLRIIPPILMGSIIYPMTGLVPDAPHYFTFITVLVLFNLAAAAICLFLGIVCKDGSVANLLGSLVMLFSLLFAGLLLNQNAIPDPAKWLQSLSIFHYGFESLIVNE

Seg: seg
820-832 seg

LGLFFFILALFGF

Seg: seg
871-881 seg

IIPLRIIPPIL

Seg: seg
932-949 seg

LLGSLVMLFSLLFAGLLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox