PRGDB00071123 (Mgr.16120)

From PRG Wiki
Jump to: navigation, search
Mgr.16120
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145601264 (XM_363162)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Magnaporthe grisea

Comment?

Magnaporthe grisea 70-15 hypothetical protein (MGG_08746) partial mRNA

DNA Sequence

ATGGGGGATAGGGACCGGGATTACGAGGAGGGGTCTCCTGACCCGGAGTCCCTCTACACCAAGGAATACTGCATTGGTGGAGGAAGCTTTGGAAAGGTCTACAAAGGAGTGGATAAGCGAACAGGCCATGCAGTTGCCATCAAGATCATTGACATCGAGAGCGCCGAAGACGAGGTCGAGGACATCATACAAGAGATTGCGATTCTGTCAGAGCTCCAGTCACCATATGTCACCAAGTATTATGGATCATACGCAAAGGGGGCCGAGCTGTGGATCGTCATGGAGTTCTGCTCCGGCGGAAGCTGCGCTGACCTCATGAAGCCTGGCTTGATTGGCGAGGAGTACATCGCCATCGTCGTCCGGGAGCTCTTGCTGGGGTTAGACTACCTCCACGCGGACAAGAAACTTCATCGAGACGTCAAAGCTGCCAATGTGTTACTTGCGGCCAATGGACAAGTCAAGCTGGCAGATTTTGGCGTTTCGGGCCAGTTGAGCGCCACCATGACCAAGAAGAACACATTCGTGGGCACACCCTTCTGGATGGCGCCCGAAGTGATAAAACAAAGCGGTTACGATCACAAGGCAGATATTTGGTCACTGGGTATTACAGCCCTTGAGCTGGCCAATGGAGAACCACCGTATGCCGATATTCATCCGATGAAGGTTCTGTTCTTGATCCCCAAAAACCCACCCCCGCGCCTTGAAGGAAACTTCACCAAGGCTTTCAAGGACTTTATCGAGCTATGTCTGCAGCGCGACCCGAAGGACCGGCCCTCCGCCAGAGAGCTGCTGCGGCATCCGTTCGTCCGACACGCCAAAAAGACGAGCTACCTGACAGAGTTGATCGAGCGCCACAGCCGCTGGAGCTCTACGCACAAGAGCGAGAACGATGAGGAGTTAGACAGTCAGTCAGACGATGAGCAGCAGCGTCAACAGCAGGCCGCCAACCGGGCGGCAGTCAACGAGGACATGTGGGACTTTGGTACCGTCAGGCTTGTTGGCGAGCGTGGTCACGTCGTTCACCGCCCGGGATTGCTCAATCCCTTGGACGAGGCCGCCACCAATGCGCGGGCAACAAGGTCCCATGAGACAGAATTTGAGCAAAATCGCCAGCGGTATCGTAGCGAGAGCCCAACCAAAAGGCTGTCGCAACAGCAGTTGGATAACGACACGGTTAAGTCGAGACAGGTCAGCCCGCAGAGGAGACCAGTTCCGAGCTCTCCAGGGAAAACAACAGTGCAAAAGATAGAAAGAGAGCCAGAGACACCGAGAGCGGTCTTGAAGCCAGCCCCTATTAGCTTTGATAGTGCGCCCTCGCCAGACTACGACAGAGAGCTACAAAAGCAATTACAGCGCGAGATGGATGGGATGAACATCGGTGATATGATAGATCCCGGTCATAAGGATAGGACGGGATTGATACCAAAGACAGGACCGGCTTCTTCACAAGCTCAGAAGCCGATTGCCCATCTAGGCCCAATCAAGCTGCCAGAGATACCGCCATTCCGTGGTAAACACGCAGGGTCCAGTCAGCCGGCAGCACAGCCACAAACACGCCAATACCAACCACCACAACCAAGGCAAATGCAACAGCAGGAGCTTCCTCCTCACCCACCGTACCGAGCACGAGACGATACCCCTGAGCCACCACAGCACCAACAGTTACCCACGCCACGACCCTTACAAACACAAGCACTACAGTACCAAcagcagcagcagcagcaACCAGGGACACCACAGCACCAAGACTTCCCCTCGCCGGCGCCGGCGCCGCCCAATGGGGAGATGGACGCTCTCAACGATGTCATCTTCCCAGCGCTTGAGGAGGCACTCAAAAGGCGGCAGATCCGACTGCAGCAACAAATCCAAGCGATGCCACCCGGCGCAGCTTCGCAGTTTGCCGGCGGTGCCCCCGCTCCCACCCCGCGACAGCAGCGGGCAGAGGCAGCGCACGAAAAGATACGGAAGCTTGTGTACCGGGTCGCGCACATGTGCAAGGAGATCGACCACTATGACAAGTCTGAGCCGGTTCATATGGACACGGGTAAGGACGCAGGGGGCACCTTTCTTGAGGGATTCCTAGAGGAAATCATGTTGAGGGTCGAACCTTTTGATGAAGGTGAGGGTTGA


Protein sequences

Name Description Sequence
Mgr.16120 translated coding region predicted by ESTScan from UniGene Mgr.16120

MGDRDRDYEEGSPDPESLYTKEYCIGGGSFGKVYKGVDKRTGHAVAIKIIDIESAEDEVEDIIQEIAILSELQSPYVTKYYGSYAKGAELWIVMEFCSGGSCADLMKPGLIGEEYIAIVVRELLLGLDYLHADKKLHRDVKAANVLLAANGQVKLADFGVSGQLSATMTKKNTFVGTPFWMAPEVIKQSGYDHKADIWSLGITALELANGEPPYADIHPMKVLFLIPKNPPPRLEGNFTKAFKDFIELCLQRDPKDRPSARELLRHPFVRHAKKTSYLTELIERHSRWSSTHKSENDEELDSQSDDEQQRQQQAANRAAVNEDMWDFGTVRLVGERGHVVHRPGLLNPLDEAATNARATRSHETEFEQNRQRYRSESPTKRLSQQQLDNDTVKSRQVSPQRRPVPSSPGKTTVQKIEREPETPRAVLKPAPISFDSAPSPDYDRELQKQLQREMDGMNIGDMIDPGHKDRTGLIPKTGPASSQAQKPIAHLGPIKLPEIPPFRGKHAGSSQPAAQPQTRQYQPPQPRQMQQQELPPHPPYRARDDTPEPPQHQQLPTPRPLQTQALQYQQQQQQQPGTPQHQDFPSPAPAPPNGEMDALNDVIFPALEEALKRRQIRLQQQIQAMPPGAASQFAGGAPAPTPRQQRAEAAHEKIRKLVYRVAHMCKEIDHYDKSEPVHMDTGKDAGGTFLEGFLEEIMLRVEPFDEGEG

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
1-444 Kinase_like
Protein kinase-like domain

MGDRDRDYEEGSPDPESLYTKEYCIGGGSFGKVYKGVDKRTGHAVAIKIIDIESAEDEVEDIIQEIAILSELQSPYVTKYYGSYAKGAELWIVMEFCSGGSCADLMKPGLIGEEYIAIVVRELLLGLDYLHADKKLHRDVKAANVLLAANGQVKLADFGVSGQLSATMTKKNTFVGTPFWMAPEVIKQSGYDHKADIWSLGITALELANGEPPYADIHPMKVLFLIPKNPPPRLEGNFTKAFKDFIELCLQRDPKDRPSARELLRHPFVRHAKKTSYLTELIERHSRWSSTHKSENDEELDSQSDDEQQRQQQAANRAAVNEDMWDFGTVRLVGERGHVVHRPGLLNPLDEAATNARATRSHETEFEQNRQRYRSESPTKRLSQQQLDNDTVKSRQVSPQRRPVPSSPGKTTVQKIEREPETPRAVLKPAPISFDSAPSPDYDR

Gene3D: G3DSA:3.30.200.20
12-97 G3DSA:3.30.200.20

SPDPESLYTKEYCIGGGSFGKVYKGVDKRTGHAVAIKIIDIESAEDEVEDIIQEIAILSELQSPYVTKYYGSYAKGAELWIVMEFC

HMMPanther: PTHR24361:SF172
14-582 PTHR24361:SF172

DPESLYTKEYCIGGGSFGKVYKGVDKRTGHAVAIKIIDIESAEDEVEDIIQEIAILSELQSPYVTKYYGSYAKGAELWIVMEFCSGGSCADLMKPGLIGEEYIAIVVRELLLGLDYLHADKKLHRDVKAANVLLAANGQVKLADFGVSGQLSATMTKKNTFVGTPFWMAPEVIKQSGYDHKADIWSLGITALELANGEPPYADIHPMKVLFLIPKNPPPRLEGNFTKAFKDFIELCLQRDPKDRPSARELLRHPFVRHAKKTSYLTELIERHSRWSSTHKSENDEELDSQSDDEQQRQQQAANRAAVNEDMWDFGTVRLVGERGHVVHRPGLLNPLDEAATNARATRSHETEFEQNRQRYRSESPTKRLSQQQLDNDTVKSRQVSPQRRPVPSSPGKTTVQKIEREPETPRAVLKPAPISFDSAPSPDYDRELQKQLQREMDGMNIGDMIDPGHKDRTGLIPKTGPASSQAQKPIAHLGPIKLPEIPPFRGKHAGSSQPAAQPQTRQYQPPQPRQMQQQELPPHPPYRARDDTPEPPQHQQLPTPRPLQTQALQYQQQQQQQPGTPQHQ

HMMPanther: PTHR24361
14-582 PTHR24361,MITOGEN-ACTIVATED KINASE KINASE KINASE

DPESLYTKEYCIGGGSFGKVYKGVDKRTGHAVAIKIIDIESAEDEVEDIIQEIAILSELQSPYVTKYYGSYAKGAELWIVMEFCSGGSCADLMKPGLIGEEYIAIVVRELLLGLDYLHADKKLHRDVKAANVLLAANGQVKLADFGVSGQLSATMTKKNTFVGTPFWMAPEVIKQSGYDHKADIWSLGITALELANGEPPYADIHPMKVLFLIPKNPPPRLEGNFTKAFKDFIELCLQRDPKDRPSARELLRHPFVRHAKKTSYLTELIERHSRWSSTHKSENDEELDSQSDDEQQRQQQAANRAAVNEDMWDFGTVRLVGERGHVVHRPGLLNPLDEAATNARATRSHETEFEQNRQRYRSESPTKRLSQQQLDNDTVKSRQVSPQRRPVPSSPGKTTVQKIEREPETPRAVLKPAPISFDSAPSPDYDRELQKQLQREMDGMNIGDMIDPGHKDRTGLIPKTGPASSQAQKPIAHLGPIKLPEIPPFRGKHAGSSQPAAQPQTRQYQPPQPRQMQQQELPPHPPYRARDDTPEPPQHQQLPTPRPLQTQALQYQQQQQQQPGTPQHQ

HMMPfam: PF00069
IPR017442
19-269 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

YTKEYCIGGGSFGKVYKGVDKRTGHAVAIKIIDIESAEDEVEDIIQEIAILSELQSPYVTKYYGSYAKGAELWIVMEFCSGGSCADLMKPGLIGEEYIAIVVRELLLGLDYLHADKKLHRDVKAANVLLAANGQVKLADFGVSGQLSATMTKKNTFVGTPFWMAPEVIKQSGYDHKADIWSLGITALELANGEPPYADIHPMKVLFLIPKNPPPRLEGNFTKAFKDFIELCLQRDPKDRPSARELLRHPFV

ProfileScan: PS50011
IPR000719
19-269 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YTKEYCIGGGSFGKVYKGVDKRTGHAVAIKIIDIESAEDEVEDIIQEIAILSELQSPYVTKYYGSYAKGAELWIVMEFCSGGSCADLMKPGLIGEEYIAIVVRELLLGLDYLHADKKLHRDVKAANVLLAANGQVKLADFGVSGQLSATMTKKNTFVGTPFWMAPEVIKQSGYDHKADIWSLGITALELANGEPPYADIHPMKVLFLIPKNPPPRLEGNFTKAFKDFIELCLQRDPKDRPSARELLRHPFV

HMMSmart: SM00220
IPR002290
19-269 S_TKc
Serine/threonine-protein kinase domain

YTKEYCIGGGSFGKVYKGVDKRTGHAVAIKIIDIESAEDEVEDIIQEIAILSELQSPYVTKYYGSYAKGAELWIVMEFCSGGSCADLMKPGLIGEEYIAIVVRELLLGLDYLHADKKLHRDVKAANVLLAANGQVKLADFGVSGQLSATMTKKNTFVGTPFWMAPEVIKQSGYDHKADIWSLGITALELANGEPPYADIHPMKVLFLIPKNPPPRLEGNFTKAFKDFIELCLQRDPKDRPSARELLRHPFV

PatternScan: PS00107
IPR017441
25-48 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGGGSFGKVYKGVDKRTGHAVAIK

Gene3D: G3DSA:1.10.510.10
99-316 G3DSA:1.10.510.10

GGSCADLMKPGLIGEEYIAIVVRELLLGLDYLHADKKLHRDVKAANVLLAANGQVKLADFGVSGQLSATMTKKNTFVGTPFWMAPEVIKQSGYDHKADIWSLGITALELANGEPPYADIHPMKVLFLIPKNPPPRLEGNFTKAFKDFIELCLQRDPKDRPSARELLRHPFVRHAKKTSYLTELIERHSRWSSTHKSENDEELDSQSDDEQQRQQQAAN






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox