PRGDB00071124 (Mgr.16155)

From PRG Wiki
Jump to: navigation, search
Mgr.16155
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145610818 (XM_368361)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Magnaporthe grisea

Comment?

Magnaporthe grisea 70-15 hypothetical protein (MGG_00883) partial mRNA

DNA Sequence

ATGTATCCCGGAAGTAGCCAATCGCGGCCCTACCAGGTGCCTCCGCCGCCGCCCATGTCGCCGCCGCTGTCTCAGATGCACCAGCAGATGAGCTTCCGCTCCGCCCCCTCCTCCTCCCGGGCCTCCTCCGGCAAGTGCACTGAACCCGCAAGCTCCGTGGAATGGGGCCCTGGGGGTGGTGTCCCGGCGCCTAGACAGGCTTACGACAACAGGTCCGGCATGTACGCTCAGGCGCCTATCCAGCAATATAACCCCCAGGCCCACGCTGCCACCGCGCCAGGCCTCAACATACCACCACCACCGCTACAGACCGACGCCCCGATGTCGGATACATACAATCCTGGACAAGATCCTATGTTTGATGGTTTTATGCCGGATTTGAGCTTCGATTTGGAACAGGAAACAATGGGATCTTCGCAGACCTGGCAGACAACGTCTTCATCGTCCACGAATACCGCGTCGGTCAACGATAATGTTCAGTCAAATGCTCCCACAGAGGAGAGAACACGGAGAAATAATTCGGCAAGCATTACGGGCACCCAGTCTAGCAGTAATGTTCCTGGCATTCCTAGCGACATAACCGCCTCATGGTCCCTTGATAAAGTCATCGCCTGGCTCCAAATGAACAGTTTCTCCCGGGACTGGCAAGAAACGTTCAAGAGCCTCAACATCCATGGCGCTCAATTCCTCGAGCTGGGGAGTGGACACTTTGGCCGAGGCAACTTTGGCATGATGCATCAACAGGTGTATCCCAAACTTGCCAAAGTGTGCACGGCAAGCGGAACTGGTTGGGATCAGCCACGGGAGCGTGAAGAAGGAAAACGGATGCGGCGCCTCATCCGTGGACTCGTCCACGCCCGAGCCGTACCAGACTCTGCCCGGGTCCCAAGCTCCCATGGAAGACAAGGATCCATCAATTCTCGCGGGAATGACAAGGGGACACACGATGGCAGCGATTCTCCCAATACTCCTATCATGAAGACACCCAGTTCTCAGTCCCGATCAACCACGATACCCACGTTCCCCGATGGTTCCTCGTTCTCCAACCACAGGGGCGTACTCAAGAACATCGACATCGATCGCCATAGCAGCCCGAAATTGAATGGGGATAGTCCTGCCGCCAGTCCGAACCCAGTAATGGCATCATCAACTCCAAAATCATCAACATTGTCTGTATCACCACATTCAAGCAGGTTCGGCAACAACGTGAGAAATAGTACCGACTCGGTCAAAGCTATATATGGCTCCGGTATACCTGCAGACGCGCAAAAGATGATGAGCAACAGCAATCTTGACGAACTCATCAACGGCCGTGGCGCACGGCAGTCTCCATCCGACTTGGGTGATAACTCGGCCGGTACCGACTCGCCTGTCAGCGCCAGAGACACCAAACTACCGTTCAGACAACGCATGCAGGCTAAAGACATAGACGGCAACCTATCTTCGCCCAACGGCGAAGGGTCACTAAGTCCACAGATGTATAGGAACGGTCTTGGTCTGGACGACTACCTACGGTTTAAAAAGCCCGGCGGCAGCATCTACCTTATGGCGACGGCTGACGGCTGGAACTATAGAGTGGTGGATGTGACGGACGTCGAGACTGTTCTTGACCTGAGATCTGAGATCAGTAGAGGCTTGGGCATTCCAGATGAAGATGGGGTTGAGTTCTATCTCACTGAACTTGGGAAGAGCGATCACAGCCAGCCGTTGGACGATAATCAGTTAATGAACCACAACAAGTCCAGAGCTGACGCAGAAGGCACGCTGAAACTATTTGTCAAGCCCCCGCCAATGTCACAACAGTCCACATGGTCGGCTGGGGACACTGGGCAACGACACAGATTTGGCACCTCGTCTTCCATGTCGAGACAGCAGAACACTTTGAAGGATGATCAATCAGAAGAGGCACGCCTTAGAGCCCAAAGGGAGTACAAAGCAGAGATTGACCGTAAAGGGCGGGAATATCTTGCTATACGTAAGGCTAAACTTGAAAGCAATAACAATGGGCTGAGCTCCTCGACCGAGGGTATTGGAATTGTAGGCAAGCCGGTCGATTTCGATACCCCTCGCCACTCTCCCTACGAGGACAAAAACACAGACAGGATGTTCCCGACCCGTAATGCTCCTGCTCCACCAGTTGCCCCCTCAGCCACGCTGAACAGGGTGAACTCCTTGATGACAGGCCAAAGAAGGGTTCAGGGAAGTATGGACGGTTATCCCTCTCAGCGTGTACCTCCAGGTGTGGGAACGACTACTTCGCCCAAAGAAATGTCCGAGGACCGCCGAAGACAACCAATGTCTGGCTCTCAGCCCATGGGAGGCATTACCAGCGCCCTGGTGGACATGGGCAGAAACCTGGGTGGAGTTGCTCTTCCCAACAGAGGCGTCAGTGCAAATAATGTACCCAGCAAACCTTCACCCCCCTATCGCGTTGCGACTGCCCCAGTTAGCGGCCGAGACTTCGTGTCACCTGACAATCGAGCTGCTTTCCCTCGCTCGCAAACCGCCGGAGATTTATCTCCCATCTCCCAGATGCCCGCCAATTTCGCGGCCTACCAGGAGCCGAACCCGTCCCCACGAGGTTTCGGCGCCGCTCCCGTCTCGTCGGCGGCCCACAAGAGGGCACCGTCTGGTCCTGATATCGATTTCACGGAACCCGAGGTTTCCTTCGACAGACCAGCGCCGTCCACGGCACAAAACGAGGCTCAGTCTGACGACGACTCAGGCGACGACTCTGACGATGGCCTGTTTGTTATTCCTATTGCGGCCCGCAAAGCCTCGATGAAGAAAGCAAAATCACGAGCCTCTGTGACTTTCGACGCCTCCGACAGTGGGGATGGGAAGCGGCCAGCTCTCACTGTCAACACCGCCAGGGATCGAAAATCGGTCTCCTTCAACTCGCCTCAGTCCGCCCGCACTGGCGATGATGACGATGATTCGGGGCGGCAGAGGAGGACGCCCAAGTCAGATATGTGGGACTCTGAGGATGGCAAGCTGGGAAGACGGAAATCTTTCAAGATGGATGTGTGGGCCAACCGTCCTCCAGCTGAAGCACTTATCAACAACCTCGAGGATTTCTTCCCCGGAATGGATGTTGATCAGCCGGTCCTCGAAGAAGGGGACCAAGAGCAAAATATTGATGGGTCACCCGTGGCACCTTCCCCCATCGCCGAGGTTGACGAGACACAGTCACCTGGCCATTTACAGATCAACGCTACGCCATTGAACTCTCTTCCTCCGTCGAGGGTGCAATCAATGTACAACGAAAGTGACACGCTTGGCTCTGATGAGTCTACGCTGAAGGCGCTCGAGCGCCCACCGAGCTTCCAGAGCCTGGCTCAACGCAGCGTGCGGCGCTCCGGCGGTCTCGGAAGAATGAAGTCCATTCGAGAGAAGGCCAGAGGTGCACACGAGGCGCATAAACGCTACACCCAGACGTCGATGGCAGCACCGCAGGGTTTGAGCCGCTCAGGCGGTACTCCTGCCACTGAGACCCAGCCCACCCAAAACAACTCGTCGGCGCTGTTGCGACGCAAGTCTACCAAGATGTTCAATGCAAACATTGTACAAATTCGACCCAACAGGGACTCGATGCTGGTGCCAGACATCCCACAGGATTCAATCTCGTCCTCGTCGCGGGGAGCTCCGAAGCACCCGACGACTTTCCGCTGGTTCAAGGGTCAACTGATTGGCAAGGGTACGTACGGACGAGTATACCTGGGTATGAACGCCACTACTGGTGAGTTCTTGGCTGTCAAGGAGGTCGAGGTCAATCCGCGGGCCGCAGCCGGTGATAAGAAGCGCATGAAGGAGCTTGTCGCGGCTCTTGACCAAGAGATTGAGACGATGCAGCATCTGGACCATGTGAACATTGTGCAATACTTGGGTTGCGAGCGGAAGGAAACGAGCATCTCAATCTTCCTAGAGTATATTTCTGGTGGCTCCATCGGGTCATGTCTGCGCAAGAACGGCAAGTTTGAGGAGTCGGTGGTACAATCCCTCACGCGGCAGACGCTGTCAGGCCTGGCCTACCTTCATCGCGAGGGTATCTTGCATCGTGATCTCAAAGCGGACAACATCTTGCTCGACGTGGATGGCACAGCCAAAATTTCTGATTTTGGTATTTCAAAGAAGACGGACAACATTTATGGCAACGACAAGTCCAATTCTATGCAGGGCTCCGTGTTTTGGATGGCACCCGAGGTTATCCGGTCGCAGGGCGAGGGATACTCTGCAAAGGTGGACATTTGGTCGCTTGGATGCGTGGTGCTTGAAATGTTTGCGGGTCGCCGGCCCTGGGCCAAAGAGGAAGCCGTCGGTGCGATTTATAAGATCGCGAACGGTGAAATTCCACCTATTCCGGAAGACGTGCAAGATACCATCAGCCCCATTGCGGTGGCTTTCATGATGGACTGCTTCACAGTCGATTCCCACGACCGACCAACGGCAAACAAGTTACTATCACAGCATCCGTTCTGCGAGCTCGATCCGAACTACAACTTCCTTGACTCGGAACTATACGCCAAGATCAGAGGGACGTACTGA


Protein sequences

Name Description Sequence
Mgr.16155 translated coding region predicted by ESTScan from UniGene Mgr.16155

MYPGSSQSRPYQVPPPPPMSPPLSQMHQQMSFRSAPSSSRASSGKCTEPASSVEWGPGGGVPAPRQAYDNRSGMYAQAPIQQYNPQAHAATAPGLNIPPPPLQTDAPMSDTYNPGQDPMFDGFMPDLSFDLEQETMGSSQTWQTTSSSSTNTASVNDNVQSNAPTEERTRRNNSASITGTQSSSNVPGIPSDITASWSLDKVIAWLQMNSFSRDWQETFKSLNIHGAQFLELGSGHFGRGNFGMMHQQVYPKLAKVCTASGTGWDQPREREEGKRMRRLIRGLVHARAVPDSARVPSSHGRQGSINSRGNDKGTHDGSDSPNTPIMKTPSSQSRSTTIPTFPDGSSFSNHRGVLKNIDIDRHSSPKLNGDSPAASPNPVMASSTPKSSTLSVSPHSSRFGNNVRNSTDSVKAIYGSGIPADAQKMMSNSNLDELINGRGARQSPSDLGDNSAGTDSPVSARDTKLPFRQRMQAKDIDGNLSSPNGEGSLSPQMYRNGLGLDDYLRFKKPGGSIYLMATADGWNYRVVDVTDVETVLDLRSEISRGLGIPDEDGVEFYLTELGKSDHSQPLDDNQLMNHNKSRADAEGTLKLFVKPPPMSQQSTWSAGDTGQRHRFGTSSSMSRQQNTLKDDQSEEARLRAQREYKAEIDRKGREYLAIRKAKLESNNNGLSSSTEGIGIVGKPVDFDTPRHSPYEDKNTDRMFPTRNAPAPPVAPSATLNRVNSLMTGQRRVQGSMDGYPSQRVPPGVGTTTSPKEMSEDRRRQPMSGSQPMGGITSALVDMGRNLGGVALPNRGVSANNVPSKPSPPYRVATAPVSGRDFVSPDNRAAFPRSQTAGDLSPISQMPANFAAYQEPNPSPRGFGAAPVSSAAHKRAPSGPDIDFTEPEVSFDRPAPSTAQNEAQSDDDSGDDSDDGLFVIPIAARKASMKKAKSRASVTFDASDSGDGKRPALTVNTARDRKSVSFNSPQSARTGDDDDDSGRQRRTPKSDMWDSEDGKLGRRKSFKMDVWANRPPAEALINNLEDFFPGMDVDQPVLEEGDQEQNIDGSPVAPSPIAEVDETQSPGHLQINATPLNSLPPSRVQSMYNESDTLGSDESTLKALERPPSFQSLAQRSVRRSGGLGRMKSIREKARGAHEAHKRYTQTSMAAPQGLSRSGGTPATETQPTQNNSSALLRRKSTKMFNANIVQIRPNRDSMLVPDIPQDSISSSSRGAPKHPTTFRWFKGQLIGKGTYGRVYLGMNATTGEFLAVKEVEVNPRAAAGDKKRMKELVAALDQEIETMQHLDHVNIVQYLGCERKETSISIFLEYISGGSIGSCLRKNGKFEESVVQSLTRQTLSGLAYLHREGILHRDLKADNILLDVDGTAKISDFGISKKTDNIYGNDKSNSMQGSVFWMAPEVIRSQGEGYSAKVDIWSLGCVVLEMFAGRRPWAKEEAVGAIYKIANGEIPPIPEDVQDTISPIAVAFMMDCFTVDSHDRPTANKLLSQHPFCELDPNYNFLDSELYAKIRGTY

Domains

Domain Start-End Description Sequence

Seg: seg
5-43 seg

SSQSRPYQVPPPPPMSPPLSQMHQQMSFRSAPSSSRASS

HMMPanther: PTHR24361:SF64
15-1492 SUBFAMILY NOT NAMED

PPPPMSPPLSQMHQQMSFRSAPSSSRASSGKCTEPASSVEWGPGGGVPAPRQAYDNRSGMYAQAPIQQYNPQAHAATAPGLNIPPPPLQTDAPMSDTYNPGQDPMFDGFMPDLSFDLEQETMGSSQTWQTTSSSSTNTASVNDNVQSNAPTEERTRRNNSASITGTQSSSNVPGIPSDITASWSLDKVIAWLQMNSFSRDWQETFKSLNIHGAQFLELGSGHFGRGNFGMMHQQVYPKLAKVCTASGTGWDQPREREEGKRMRRLIRGLVHARAVPDSARVPSSHGRQGSINSRGNDKGTHDGSDSPNTPIMKTPSSQSRSTTIPTFPDGSSFSNHRGVLKNIDIDRHSSPKLNGDSPAASPNPVMASSTPKSSTLSVSPHSSRFGNNVRNSTDSVKAIYGSGIPADAQKMMSNSNLDELINGRGARQSPSDLGDNSAGTDSPVSARDTKLPFRQRMQAKDIDGNLSSPNGEGSLSPQMYRNGLGLDDYLRFKKPGGSIYLMATADGWNYRVVDVTDVETVLDLRSEISRGLGIPDEDGVEFYLTELGKSDHSQPLDDNQLMNHNKSRADAEGTLKLFVKPPPMSQQSTWSAGDTGQRHRFGTSSSMSRQQNTLKDDQSEEARLRAQREYKAEIDRKGREYLAIRKAKLESNNNGLSSSTEGIGIVGKPVDFDTPRHSPYEDKNTDRMFPTRNAPAPPVAPSATLNRVNSLMTGQRRVQGSMDGYPSQRVPPGVGTTTSPKEMSEDRRRQPMSGSQPMGGITSALVDMGRNLGGVALPNRGVSANNVPSKPSPPYRVATAPVSGRDFVSPDNRAAFPRSQTAGDLSPISQMPANFAAYQEPNPSPRGFGAAPVSSAAHKRAPSGPDIDFTEPEVSFDRPAPSTAQNEAQSDDDSGDDSDDGLFVIPIAARKASMKKAKSRASVTFDASDSGDGKRPALTVNTARDRKSVSFNSPQSARTGDDDDDSGRQRRTPKSDMWDSEDGKLGRRKSFKMDVWANRPPAEALINNLEDFFPGMDVDQPVLEEGDQEQNIDGSPVAPSPIAEVDETQSPGHLQINATPLNSLPPSRVQSMYNESDTLGSDESTLKALERPPSFQSLAQRSVRRSGGLGRMKSIREKARGAHEAHKRYTQTSMAAPQGLSRSGGTPATETQPTQNNSSALLRRKSTKMFNANIVQIRPNRDSMLVPDIPQDSISSSSRGAPKHPTTFRWFKGQLIGKGTYGRVYLGMNATTGEFLAVKEVEVNPRAAAGDKKRMKELVAALDQEIETMQHLDHVNIVQYLGCERKETSISIFLEYISGGSIGSCLRKNGKFEESVVQSLTRQTLSGLAYLHREGILHRDLKADNILLDVDGTAKISDFGISKKTDNIYGNDKSNSMQGSVFWMAPEVIRSQGEGYSAKVDIWSLGCVVLEMFAGRRPWAKEEAVGAIYKIANGEIPPIPEDVQDTISPIAVAFMMDCFTVDSHDRPTANKLLSQHPF

HMMPanther: PTHR24361
15-1492 FAMILY NOT NAMED,MITOGEN-ACTIVATED KINASE KINASE KINASE

PPPPMSPPLSQMHQQMSFRSAPSSSRASSGKCTEPASSVEWGPGGGVPAPRQAYDNRSGMYAQAPIQQYNPQAHAATAPGLNIPPPPLQTDAPMSDTYNPGQDPMFDGFMPDLSFDLEQETMGSSQTWQTTSSSSTNTASVNDNVQSNAPTEERTRRNNSASITGTQSSSNVPGIPSDITASWSLDKVIAWLQMNSFSRDWQETFKSLNIHGAQFLELGSGHFGRGNFGMMHQQVYPKLAKVCTASGTGWDQPREREEGKRMRRLIRGLVHARAVPDSARVPSSHGRQGSINSRGNDKGTHDGSDSPNTPIMKTPSSQSRSTTIPTFPDGSSFSNHRGVLKNIDIDRHSSPKLNGDSPAASPNPVMASSTPKSSTLSVSPHSSRFGNNVRNSTDSVKAIYGSGIPADAQKMMSNSNLDELINGRGARQSPSDLGDNSAGTDSPVSARDTKLPFRQRMQAKDIDGNLSSPNGEGSLSPQMYRNGLGLDDYLRFKKPGGSIYLMATADGWNYRVVDVTDVETVLDLRSEISRGLGIPDEDGVEFYLTELGKSDHSQPLDDNQLMNHNKSRADAEGTLKLFVKPPPMSQQSTWSAGDTGQRHRFGTSSSMSRQQNTLKDDQSEEARLRAQREYKAEIDRKGREYLAIRKAKLESNNNGLSSSTEGIGIVGKPVDFDTPRHSPYEDKNTDRMFPTRNAPAPPVAPSATLNRVNSLMTGQRRVQGSMDGYPSQRVPPGVGTTTSPKEMSEDRRRQPMSGSQPMGGITSALVDMGRNLGGVALPNRGVSANNVPSKPSPPYRVATAPVSGRDFVSPDNRAAFPRSQTAGDLSPISQMPANFAAYQEPNPSPRGFGAAPVSSAAHKRAPSGPDIDFTEPEVSFDRPAPSTAQNEAQSDDDSGDDSDDGLFVIPIAARKASMKKAKSRASVTFDASDSGDGKRPALTVNTARDRKSVSFNSPQSARTGDDDDDSGRQRRTPKSDMWDSEDGKLGRRKSFKMDVWANRPPAEALINNLEDFFPGMDVDQPVLEEGDQEQNIDGSPVAPSPIAEVDETQSPGHLQINATPLNSLPPSRVQSMYNESDTLGSDESTLKALERPPSFQSLAQRSVRRSGGLGRMKSIREKARGAHEAHKRYTQTSMAAPQGLSRSGGTPATETQPTQNNSSALLRRKSTKMFNANIVQIRPNRDSMLVPDIPQDSISSSSRGAPKHPTTFRWFKGQLIGKGTYGRVYLGMNATTGEFLAVKEVEVNPRAAAGDKKRMKELVAALDQEIETMQHLDHVNIVQYLGCERKETSISIFLEYISGGSIGSCLRKNGKFEESVVQSLTRQTLSGLAYLHREGILHRDLKADNILLDVDGTAKISDFGISKKTDNIYGNDKSNSMQGSVFWMAPEVIRSQGEGYSAKVDIWSLGCVVLEMFAGRRPWAKEEAVGAIYKIANGEIPPIPEDVQDTISPIAVAFMMDCFTVDSHDRPTANKLLSQHPF

Seg: seg
138-154 seg

SSQTWQTTSSSSTNTAS

Seg: seg
382-394 seg

SSTPKSSTLSVSP

Seg: seg
526-538 seg

VVDVTDVETVLDL

Seg: seg
904-915 seg

SDDDSGDDSDDG

Seg: seg
922-936 seg

AARKASMKKAKSRAS

Seg: seg
975-979 seg

DDDDD

Seg: seg
1207-1212 seg

SISSSS

Gene3D: G3DSA:3.30.200.20
1208-1327 no description

ISSSSRGAPKHPTTFRWFKGQLIGKGTYGRVYLGMNATTGEFLAVKEVEVNPRAAAGDKKRMKELVAALDQEIETMQHLDHVNIVQYLGCERKETSISIFLEYISGGSIGSCLRKNGKFE

superfamily: SSF56112
IPR011009
1210-1488 Protein kinase-like (PK-like)
Protein kinase-like domain

SSSRGAPKHPTTFRWFKGQLIGKGTYGRVYLGMNATTGEFLAVKEVEVNPRAAAGDKKRMKELVAALDQEIETMQHLDHVNIVQYLGCERKETSISIFLEYISGGSIGSCLRKNGKFEESVVQSLTRQTLSGLAYLHREGILHRDLKADNILLDVDGTAKISDFGISKKTDNIYGNDKSNSMQGSVFWMAPEVIRSQGEGYSAKVDIWSLGCVVLEMFAGRRPWAKEEAVGAIYKIANGEIPPIPEDVQDTISPIAVAFMMDCFTVDSHDRPTANKLLS

ProfileScan: PS50011
IPR000719
1224-1493 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

WFKGQLIGKGTYGRVYLGMNATTGEFLAVKEVEVNPRAAAGDKKRMKELVAALDQEIETMQHLDHVNIVQYLGCERKETSISIFLEYISGGSIGSCLRKNGKFEESVVQSLTRQTLSGLAYLHREGILHRDLKADNILLDVDGTAKISDFGISKKTDNIYGNDKSNSMQGSVFWMAPEVIRSQGEGYSAKVDIWSLGCVVLEMFAGRRPWAKEEAVGAIYKIANGEIPPIPEDVQDTISPIAVAFMMDCFTVDSHDRPTANKLLSQHPFC

HMMSmart: SM00219
IPR020635
1224-1490 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

WFKGQLIGKGTYGRVYLGMNATTGEFLAVKEVEVNPRAAAGDKKRMKELVAALDQEIETMQHLDHVNIVQYLGCERKETSISIFLEYISGGSIGSCLRKNGKFEESVVQSLTRQTLSGLAYLHREGILHRDLKADNILLDVDGTAKISDFGISKKTDNIYGNDKSNSMQGSVFWMAPEVIRSQGEGYSAKVDIWSLGCVVLEMFAGRRPWAKEEAVGAIYKIANGEIPPIPEDVQDTISPIAVAFMMDCFTVDSHDRPTANKLLSQH

HMMSmart: SM00220
IPR002290
1224-1493 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

WFKGQLIGKGTYGRVYLGMNATTGEFLAVKEVEVNPRAAAGDKKRMKELVAALDQEIETMQHLDHVNIVQYLGCERKETSISIFLEYISGGSIGSCLRKNGKFEESVVQSLTRQTLSGLAYLHREGILHRDLKADNILLDVDGTAKISDFGISKKTDNIYGNDKSNSMQGSVFWMAPEVIRSQGEGYSAKVDIWSLGCVVLEMFAGRRPWAKEEAVGAIYKIANGEIPPIPEDVQDTISPIAVAFMMDCFTVDSHDRPTANKLLSQHPFC

HMMPfam: PF00069
IPR017442
1227-1489 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

GQLIGKGTYGRVYLGMNATTGEFLAVKEVEVNPRAAAGDKKRMKELVAALDQEIETMQHLDHVNIVQYLGCERKETSISIFLEYISGGSIGSCLRKNGKFEESVVQSLTRQTLSGLAYLHREGILHRDLKADNILLDVDGTAKISDFGISKKTDNIYGNDKSNSMQGSVFWMAPEVIRSQGEGYSAKVDIWSLGCVVLEMFAGRRPWAKEEAVGAIYKIANGEIPPIPEDVQDTISPIAVAFMMDCFTVDSHDRPTANKLLSQ

PatternScan: PS00107
IPR017441
1230-1253 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGKGTYGRVYLGMNATTGEFLAVK

Coil: coil
1266-1287 coiled-coil

KKRMKELVAALDQEIETMQHLD

Gene3D: G3DSA:1.10.510.10
1328-1493 no description

ESVVQSLTRQTLSGLAYLHREGILHRDLKADNILLDVDGTAKISDFGISKKTDNIYGNDKSNSMQGSVFWMAPEVIRSQGEGYSAKVDIWSLGCVVLEMFAGRRPWAKEEAVGAIYKIANGEIPPIPEDVQDTISPIAVAFMMDCFTVDSHDRPTANKLLSQHPFC

PatternScan: PS00108
IPR008271
1350-1362 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

ILHRDLKADNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox