PRGDB00071125 (Mgr.16188)

From PRG Wiki
Jump to: navigation, search
Mgr.16188
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145614189 (XM_364073)
Gene Class N
Domain Type NBS
Gene Species Magnaporthe grisea

Comment?

Magnaporthe grisea 70-15 hypothetical protein (MGG_08918) partial mRNA

DNA Sequence

ATGAGTGCCCATCACGGTTATTCAGAGCCGGCGCGGCAGTCTGATCACCGGTCCGAGTTTCACTCTCAACACGCTTCGGACCTTGGCAAGGATGGAGCAGATGTCGAGTCTTCGTCGGCCTCGGGGGCACATCTCCTCAACACTACCGTCAAGTCGATCTCTTGGACGAACATCACCGTCAAAGTGACCGATAGGGATACGAAGCAGCCACGGCTCATTCTTGACAACGTCGAGGGCATTGTCAACGCAGGTGAACTCGTTGCCCTCATGGGCCCGTCGGGCTGCGGCAAGACGACCCTCCTAAACATGCTGGCCTCGCGTCCTACCGGAGCCGGATCCACCGACGGAGTCGTCCTCGTAAACGGCACAGAGCCCTCCCGCGCCGCCTTTCGACAGATGAGCTGCTTCGTGGAGCAGGAGGATGCGCTGATCGGGTCTCTGAACGTCCGGGAGACTCTGATGTTTGCCTCGCGCCTGTCAACCAGCAGCGGCTCGCTCTCGAGCAAGGAGAGAACCAGGCGCGTCGATGGGTTGCTTGCTGCCTTTGGCCTGTCCGACCAGGCCTCCACGTTGATCGGCACTCCCATCCGCAAGGGTATAAGTGGTGGCCAGAAGCGCCGTGTCGGTGTGGCCAGCCAGCTCATCACCAGCCCAAAGATCCTCTTTCTCGACGAACCCACCAGCGGGCTTGATTCGGCCGCCAGCAGAGAGGTCATGAGCTACTTGAAGAGCGTGGCCAAGCGTAACAATTTGATTGTGATCGCCAGTATACACCAGCCGTCCACCTCCACCTTTATGCTCTTTGACAAACTCTGTCTCCTGTCCCAGGGCAAGCAGCACTACTTTGGCCCCGTCACCGAGGTCGTCCCTTACTACGAGTCGATAGGCCTCGACGTTCCCGTGCACTCCAACCCGGCCGAGTGGCTCCTCGAGCTGATCAACGTCGACTTTGCAGAGGACAGAGCGAACGCGCAGACACTGCTGGGCAGGCTACAAGAGGCGTGGACCAGCTCGTCGCGTTGCCAGCAGCTGCGCGCTGGCCTGCGTCAGGTCGAATCGTTTGGATCGACAGGCGCAGAGACCCTAGTTGGCTCGGGCGGTCATTCTGAGAGGAAGCCAGGACAGCTCAGCCTGGTCCTGACGCTTCTCCATCGCTCCTTTGTCAAAAGCCACCGTGACGTGGTTGCCTATGGGATCAGGATGGCCATGTATACTGGTCTAGCCATCATGATGGTCTTTGGCTCGGCTTTCATGTCCTTCATGGCGGTTGCCTATGTTCCCTCGTTCATCGAAGATCGGCTGCAGTACGTCAAGGAGCACCACAACGGTCTATATGGTGCAACGGCCCTCATGATATCCAACTTCCTCATTGGTATCCCATATTTATTCCTCATCGCCATCTCCTTCTCTGCCATCTCGTACTGGCTCAACAACTTCCAGCCGACCGCACATGCCTTCTTCGTATGGGTCATGTGGGTCTTTCTCGACCTTTTGGCCGCCGAGAGCCTGGTGGTCTTGTTCACTTCGCTGTTCCCCAGCTTCGTCATCTCCCTGGCTCTCGTGGCATTCGCCAACGGGCTGTGGATGTCGGTGAACGGTTTCATGGTTCAACCAACCATCTTGAACGTCTTTTACAAATACGTTTTTCATTATTGGGACTACCAAAAGTACGTCTTTGAAGGCATGATGATCAACGAGTTCGCCGACCGCTCCTACGGGTGCGGGGATTCCTGCCAGTGCATGTACGTCACGGAGCTTGCCGACCAGTGCAAGATTGCCGGCGAGGGAGTGTTGAGGCAGTATGGCTACAGCACAGGCCACACGGGCCACGACGTTGGTATCATGGTGGCCATAATTGCAGGATATCGGATAGCGGGCTGGATCGCGCTCAAGTTGAGGACCTGA


Protein sequences

Name Description Sequence
Mgr.16188 translated coding region predicted by ESTScan from UniGene Mgr.16188

MSAHHGYSEPARQSDHRSEFHSQHASDLGKDGADVESSSASGAHLLNTTVKSISWTNITVKVTDRDTKQPRLILDNVEGIVNAGELVALMGPSGCGKTTLLNMLASRPTGAGSTDGVVLVNGTEPSRAAFRQMSCFVEQEDALIGSLNVRETLMFASRLSTSSGSLSSKERTRRVDGLLAAFGLSDQASTLIGTPIRKGISGGQKRRVGVASQLITSPKILFLDEPTSGLDSAASREVMSYLKSVAKRNNLIVIASIHQPSTSTFMLFDKLCLLSQGKQHYFGPVTEVVPYYESIGLDVPVHSNPAEWLLELINVDFAEDRANAQTLLGRLQEAWTSSSRCQQLRAGLRQVESFGSTGAETLVGSGGHSERKPGQLSLVLTLLHRSFVKSHRDVVAYGIRMAMYTGLAIMMVFGSAFMSFMAVAYVPSFIEDRLQYVKEHHNGLYGATALMISNFLIGIPYLFLIAISFSAISYWLNNFQPTAHAFFVWVMWVFLDLLAAESLVVLFTSLFPSFVISLALVAFANGLWMSVNGFMVQPTILNVFYKYVFHYWDYQKYVFEGMMINEFADRSYGCGDSCQCMYVTELADQCKIAGEGVLRQYGYSTGHTGHDVGIMVAIIAGYRIAGWIALKLRT

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR19241
31-633 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

DGADVESSSASGAHLLNTTVKSISWTNITVKVTDRDTKQPRLILDNVEGIVNAGELVALMGPSGCGKTTLLNMLASRPTGAGSTDGVVLVNGTEPSRAAFRQMSCFVEQEDALIGSLNVRETLMFASRLSTSSGSLSSKERTRRVDGLLAAFGLSDQASTLIGTPIRKGISGGQKRRVGVASQLITSPKILFLDEPTSGLDSAASREVMSYLKSVAKRNNLIVIASIHQPSTSTFMLFDKLCLLSQGKQHYFGPVTEVVPYYESIGLDVPVHSNPAEWLLELINVDFAEDRANAQTLLGRLQEAWTSSSRCQQLRAGLRQVESFGSTGAETLVGSGGHSERKPGQLSLVLTLLHRSFVKSHRDVVAYGIRMAMYTGLAIMMVFGSAFMSFMAVAYVPSFIEDRLQYVKEHHNGLYGATALMISNFLIGIPYLFLIAISFSAISYWLNNFQPTAHAFFVWVMWVFLDLLAAESLVVLFTSLFPSFVISLALVAFANGLWMSVNGFMVQPTILNVFYKYVFHYWDYQKYVFEGMMINEFADRSYGCGDSCQCMYVTELADQCKIAGEGVLRQYGYSTGHTGHDVGIMVAIIAGYRIAGWIALKLR

HMMPanther: PTHR19241:SF57
31-633 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

DGADVESSSASGAHLLNTTVKSISWTNITVKVTDRDTKQPRLILDNVEGIVNAGELVALMGPSGCGKTTLLNMLASRPTGAGSTDGVVLVNGTEPSRAAFRQMSCFVEQEDALIGSLNVRETLMFASRLSTSSGSLSSKERTRRVDGLLAAFGLSDQASTLIGTPIRKGISGGQKRRVGVASQLITSPKILFLDEPTSGLDSAASREVMSYLKSVAKRNNLIVIASIHQPSTSTFMLFDKLCLLSQGKQHYFGPVTEVVPYYESIGLDVPVHSNPAEWLLELINVDFAEDRANAQTLLGRLQEAWTSSSRCQQLRAGLRQVESFGSTGAETLVGSGGHSERKPGQLSLVLTLLHRSFVKSHRDVVAYGIRMAMYTGLAIMMVFGSAFMSFMAVAYVPSFIEDRLQYVKEHHNGLYGATALMISNFLIGIPYLFLIAISFSAISYWLNNFQPTAHAFFVWVMWVFLDLLAAESLVVLFTSLFPSFVISLALVAFANGLWMSVNGFMVQPTILNVFYKYVFHYWDYQKYVFEGMMINEFADRSYGCGDSCQCMYVTELADQCKIAGEGVLRQYGYSTGHTGHDVGIMVAIIAGYRIAGWIALKLR

Gene3D: G3DSA:3.40.50.300
52-289 no description

SISWTNITVKVTDRDTKQPRLILDNVEGIVNAGELVALMGPSGCGKTTLLNMLASRPTGAGSTDGVVLVNGTEPSRAAFRQMSCFVEQEDALIGSLNVRETLMFASRLSTSSGSLSSKERTRRVDGLLAAFGLSDQASTLIGTPIRKGISGGQKRRVGVASQLITSPKILFLDEPTSGLDSAASREVMSYLKSVAKRNNLIVIASIHQPSTSTFMLFDKLCLLSQGKQHYFGPVTEVV

ProfileScan: PS50893
IPR003439
53-301 ABC_TRANSPORTER_2
ABC transporter-like

ISWTNITVKVTDRDTKQPRLILDNVEGIVNAGELVALMGPSGCGKTTLLNMLASRPTGAGSTDGVVLVNGTEPSRAAFRQMSCFVEQEDALIGSLNVRETLMFASRLSTSSGSLSSKERTRRVDGLLAAFGLSDQASTLIGTPIRKGISGGQKRRVGVASQLITSPKILFLDEPTSGLDSAASREVMSYLKSVAKRNNLIVIASIHQPSTSTFMLFDKLCLLSQGKQHYFGPVTEVVPYYESIGLDVPV

superfamily: SSF52540
53-287 P-loop containing nucleoside triphosphate hydrolases

ISWTNITVKVTDRDTKQPRLILDNVEGIVNAGELVALMGPSGCGKTTLLNMLASRPTGAGSTDGVVLVNGTEPSRAAFRQMSCFVEQEDALIGSLNVRETLMFASRLSTSSGSLSSKERTRRVDGLLAAFGLSDQASTLIGTPIRKGISGGQKRRVGVASQLITSPKILFLDEPTSGLDSAASREVMSYLKSVAKRNNLIVIASIHQPSTSTFMLFDKLCLLSQGKQHYFGPVTE

HMMSmart: SM00382
IPR003593
83-278 ATPases associated with a variety of cellula,NBS
AAA+ ATPase domain

AGELVALMGPSGCGKTTLLNMLASRPTGAGSTDGVVLVNGTEPSRAAFRQMSCFVEQEDALIGSLNVRETLMFASRLSTSSGSLSSKERTRRVDGLLAAFGLSDQASTLIGTPIRKGISGGQKRRVGVASQLITSPKILFLDEPTSGLDSAASREVMSYLKSVAKRNNLIVIASIHQPSTSTFMLFDKLCLLSQGK

HMMPfam: PF00005
IPR003439
98-228 ABC_tran
ABC transporter-like

TTLLNMLASRPTGAGSTDGVVLVNGTEPSRAAFRQMSCFVEQEDALIGSLNVRETLMFASRLSTSSGSLSSKERTRRVDGLLAAFGLSDQASTLIGTPIRKGISGGQKRRVGVASQLITSPKILFLDEPTS

Seg: seg
157-168 seg

SRLSTSSGSLSS

PatternScan: PS00211
IPR017871
200-214 ABC_TRANSPORTER_1
ABC transporter, conserved site

ISGGQKRRVGVASQL

HMMPfam: PF01061
IPR013525
397-567 ABC2_membrane
ABC-2 type transporter

YGIRMAMYTGLAIMMVFGSAFMSFMAVAYVPSFIEDRLQYVKEHHNGLYGATALMISNFLIGIPYLFLIAISFSAISYWLNNFQPTAHAFFVWVMWVFLDLLAAESLVVLFTSLFPSFVISLALVAFANGLWMSVNGFMVQPTILNVFYKYVFHYWDYQKYVFEGMMINEF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox