PRGDB00071126 (Mgr.18194)

From PRG Wiki
Jump to: navigation, search
Mgr.18194
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 30401646 (BU641940)
Gene Class Unknown
Domain Type
Gene Species Magnaporthe grisea

Comment?

mgmk008xP06f.b pmk1 in pBluescriptII sk(-) plasmid Magnaporthe grisea cDNA clone mgmk008xP06 5', mRNA sequence

DNA Sequence

CAACACATCGGCGGCGGTTGAGATTATAGCAGCAATCATGGCTACCAAGAAAGAAGAAACCTTCTATGAGCTCTACCGCCGTACTAGTCTGGGCATATGTCTCACAGATGCTCTGGACGATCTCATCACGAACGATCGTATCAACCCTCAACTCGCCATGAAGATTCTGGCGAATTTTGATCGTGTTGGGGCTGAAACTTTGCAAGGAAAAGTCAAAGCCAGACTTCAGTTCAAGGGAGCTTTCGACAACTACCGCTTTTGCGACGACGTATGGACCTTTGGGATCCAGAACATTAACTTTAAGCTGGATGGGGGCAATTAAAACATTCAAGCCGACCAAAGTCAAGATTG


Protein sequences

Name Description Sequence
Mgr.18194 translated coding region predicted by ESTScan from UniGene Mgr.18194

XNTSAAVEIIAAIMATKKEETFYELYRRTSLGICLTDALDDLITNDRINPQLAMKILANFDRVGAETLQGKVKARLQFKGAFDNYRFCDDVWTFGIQNINFKLDGGN

Domains

Domain Start-End Description Sequence

HMMPIR: PIRSF009415
IPR003194
18-107 Transcription initiation factor IIA, gamma subunit
Transcription initiation factor IIA, gamma subunit

KEETFYELYRRTSLGICLTDALDDLITNDRINPQLAMKILANFDRVGAETLQGKVKARLQFKGAFDNYRFCDDVWTFGIQNINFKLDGGN

Gene3D: G3DSA:1.10.287.190
IPR015872
20-73 no description
Transcription initiation factor IIA, gamma subunit

ETFYELYRRTSLGICLTDALDDLITNDRINPQLAMKILANFDRVGAETLQGKVK

HMMPfam: PF02268
IPR015872
22-69 TFIIA_gamma_N
Transcription initiation factor IIA, gamma subunit

FYELYRRTSLGICLTDALDDLITNDRINPQLAMKILANFDRVGAETLQ

BlastProDom: PD009224
IPR015872
22-68 Q4WZV0_ASPFU_Q4WZV0;
Transcription initiation factor IIA, gamma subunit

FYELYRRTSLGICLTDALDDLITNDRINPQLAMKILANFDRVGAETL

superfamily: SSF47396
IPR009083
23-73 Transcription factor IIA (TFIIA), alpha-helical domain
Transcription factor IIA, helical

YELYRRTSLGICLTDALDDLITNDRINPQLAMKILANFDRVGAETLQGKVK

HMMPanther: PTHR10966
IPR003194
23-102 TRANSCRIPTION INITIATION FACTOR IIA SUBUNIT 2
Transcription initiation factor IIA, gamma subunit

YELYRRTSLGICLTDALDDLITNDRINPQLAMKILANFDRVGAETLQGKVKARLQFKGAFDNYRFCDDVWTFGIQNINFK

superfamily: SSF50784
IPR009088
71-105 Transcription factor IIA (TFIIA), beta-barrel domain
Transcription factor IIA, beta-barrel

KVKARLQFKGAFDNYRFCDDVWTFGIQNINFKLDG

HMMPfam: PF02751
IPR015871
71-104 TFIIA_gamma_C
Transcription initiation factor IIA, gamma subunit

KVKARLQFKGAFDNYRFCDDVWTFGIQNINFKLD

Gene3D: G3DSA:2.30.18.10
IPR009088
75-105 no description
Transcription factor IIA, beta-barrel

RLQFKGAFDNYRFCDDVWTFGIQNINFKLDG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox