PRGDB00071127 (Mgr.18283)

From PRG Wiki
Jump to: navigation, search
Mgr.18283
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145610922 (XM_368441)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Magnaporthe grisea

Comment?

Magnaporthe grisea 70-15 conserved hypothetical protein (MGG_00803) partial mRNA

DNA Sequence

ATGGCCCACTGCCAGGACCGAGGCAGCAATTCGCGGCGTGGAAGTTTGGCCCACGGAACCTTTGAGGACGAGGAGCTGTCGTTATCCTTGACTGCCATCGACCCTCGGAACACGGCCGCGACCACGACAAGGACGACCCCGACCCAGCATCGACGCGACGACAGCAACGGCCGGCCTCGACCCAAGCATAGTCACAGCCACAGCCGCCGCCATTCGCAACACGCACAACATCAAAATCAGCACCAGAATCAGGATCAGAATCAGCAATCCCCTCCATCCGCCATGCCACCCACTGTCCACCgcggcggcggcggcggcggcCCCAATGCCATGCCTGCGGATGGAAGCACCAGTAGCAAGATACGAGTCGACCAGCGCATCAGCGCCTACGAGATCAGCAAAACCCTAGGTGAAGGTTCGTTCGGCAAGGTCAAGTTGGCCGTACACAAGGGAACAAAGCAAATGGTCGCGCTCAAGATCATCTCGCGCAAACGCCTCGCTAGTACCGACATGGCCGGTCGCGTCGAGAGAGAAATTGAGTACCTGCAGCTTCTCCGCCACCCCCACATCATCAAACTCTACACCGTTATCAAGACCGACAACGAGATCATAATGGTCCTCGAATATGCCGGCGGGGAGCTCTTCGACCATATAGTCACCAACGGCCGTCTGAGCGAGGATGAAGCCCGGCGCTTTTTCCAGCAAATGTTGTGCGCTGTCGAGTACTGTCACAGGCACAAGATTGTCCACCGTGATCTCAAGCCTGAAAACCTGCTGCTGGATGATAATCTCAACGTCAAGATTGCCGATTTTGGTCTCAGTAATATCATGACGGATGGAAACTTTCTCAAGACGAGTTGCGGAAGCCCAAACTATGCTGCGCCTGAAGTTATTAGCGGAAAGCTGTACGCGGGATCTGAGGTGGACGTCTGGAGCTGTGGTGTCATCCTGTATGTCCTGCTGGTTGGCAGGCTACCTTTCGACGATGACCATATTCCCACGCTCTTCTCCAAGATCGCCAGGGGAACATACGTTGTGCCCCACTGGATGAGTCCAGGTGCTGCCGCGTTGATCAAGAAGATGCTTGTGGTAAACCCCGTCAACCGTGCCACCATCACCGAGATACGGCAGGACCCCTGGTTCACAACCGAACTACCAGAGTACCTACAGCCGCCCATAGAGCCATTCTTCAATACGGGCATAGATCCAGAGAAGGCGATTCGGCCCAGCGACATCGCGCCAAATGCTCCTCCAAAGGTCCAGGAAAAGCTTCACGCCGAAGTCACTGACAAAATTTCAAAGACCATGGGTTACGGCAAGCAGGACGTTCTCGACGCTCTGGAAGCCGAAGAGCCTTCCGCTATCAAGGATGCGTACATGATTGTGCGCGAGAACAAGATGATGCAGAGTAATCCGGCCCTTGGGGGAGACAACCCGTTCTTTGCTACTACGCCTCTGGGTGATGAAAATGGATCCACCGGTATCATGGAGACCATGGATTCAGCCATGTCAGCTTCTGGCCACGACCCTAATGCAAGCCCCATGACGAGCATGTCCGTCAGATCGGCCACGTCTAGCACTCTCAGCGCCGCCCTGGCATATCAACGGCCATATACGAGCAAGATTGGTATCCTCCCCAGCAGCTTACCAGCGTACCATAACGCGTATATGGAGAGCGAGAAGTCGGGCACGGCTCAAGATGTGCCTGATATGATGGCACTGAATGAGCCGCCAGCACCAGCTAGGACTCCAGCAGAACAGGAGGAGACTGCGAGGAGACTGCGGCCGCACGCGCGTAGTAGCCAGAGCGCCGCTGATTCCAAACCCCAAAGTTTGACTCCCTCAAACGCCCCCAAGAAAACCAAACCCACCAGATGGCAATTTGGTATTCGCTCACGAAACGCACCATTCGAGGCTTTGTTGTGTATCTACAAGGCTCTCAAGAAGCTTGACTGCTCCTGGAAAATTGATCGAGACTATCACAAGGTGCATGGCGATGAGAACGAAAAACATCGCTCAAGAGGCGACGCAGGAACACCTTATATATTACCGGCAGATCCATGGCATATCGAAGCACGATGGGAGACTGGTCCTCTCCGAACCCACTCGGTAATGACGGATCCAAAGAACTCAGCCGCGTTCCCAGGCGGCAAAGTGAGGGTTCAGAAAAAGCACAGCAACAACAGCTCGGAAGACGATGACGAGGAAGCAAACGCCACCTACGAGGTGATCGCCATGCGACTTTCCATACAGATCTACGAAATGGAGAGTGGCGTGTACCTGGTAGACTTCAAGTGCGCAGGCTACGAATTGCCTGATGGTAGGCTGATGGAGGAAAAGGATGTGACCAGTCCATTCCCCTTCCTGGACCTGGCGGCCCGGCTCATTATACAGCTTGCCGATGCTGACTAG


Protein sequences

Name Description Sequence
Mgr.18283 translated coding region predicted by ESTScan from UniGene Mgr.18283

MAHCQDRGSNSRRGSLAHGTFEDEELSLSLTAIDPRNTAATTTRTTPTQHRRDDSNGRPRPKHSHSHSRRHSQHAQHQNQHQNQDQNQQSPPSAMPPTVHRGGGGGGPNAMPADGSTSSKIRVDQRISAYEISKTLGEGSFGKVKLAVHKGTKQMVALKIISRKRLASTDMAGRVEREIEYLQLLRHPHIIKLYTVIKTDNEIIMVLEYAGGELFDHIVTNGRLSEDEARRFFQQMLCAVEYCHRHKIVHRDLKPENLLLDDNLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEVISGKLYAGSEVDVWSCGVILYVLLVGRLPFDDDHIPTLFSKIARGTYVVPHWMSPGAAALIKKMLVVNPVNRATITEIRQDPWFTTELPEYLQPPIEPFFNTGIDPEKAIRPSDIAPNAPPKVQEKLHAEVTDKISKTMGYGKQDVLDALEAEEPSAIKDAYMIVRENKMMQSNPALGGDNPFFATTPLGDENGSTGIMETMDSAMSASGHDPNASPMTSMSVRSATSSTLSAALAYQRPYTSKIGILPSSLPAYHNAYMESEKSGTAQDVPDMMALNEPPAPARTPAEQEETARRLRPHARSSQSAADSKPQSLTPSNAPKKTKPTRWQFGIRSRNAPFEALLCIYKALKKLDCSWKIDRDYHKVHGDENEKHRSRGDAGTPYILPADPWHIEARWETGPLRTHSVMTDPKNSAAFPGGKVRVQKKHSNNSSEDDDEEANATYEVIAMRLSIQIYEMESGVYLVDFKCAGYELPDGRLMEEKDVTSPFPFLDLAARLIIQLADAD

Domains

Domain Start-End Description Sequence

Seg: seg
35-48 seg

PRNTAATTTRTTPT

Seg: seg
58-93 seg

RPRPKHSHSHSRRHSQHAQHQNQHQNQDQNQQSPPS

Seg: seg
102-107 seg

GGGGGG

Gene3D: G3DSA:3.30.200.20
114-227 no description

DGSTSSKIRVDQRISAYEISKTLGEGSFGKVKLAVHKGTKQMVALKIISRKRLASTDMAGRVEREIEYLQLLRHPHIIKLYTVIKTDNEIIMVLEYAGGELFDHIVTNGRLSED

superfamily: SSF56112
IPR011009
116-409 Protein kinase-like (PK-like)
Protein kinase-like domain

STSSKIRVDQRISAYEISKTLGEGSFGKVKLAVHKGTKQMVALKIISRKRLASTDMAGRVEREIEYLQLLRHPHIIKLYTVIKTDNEIIMVLEYAGGELFDHIVTNGRLSEDEARRFFQQMLCAVEYCHRHKIVHRDLKPENLLLDDNLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEVISGKLYAGSEVDVWSCGVILYVLLVGRLPFDDDHIPTLFSKIARGTYVVPHWMSPGAAALIKKMLVVNPVNRATITEIRQDPWFTTELPEYLQPPIEPFFNTGIDPEKAIRP

HMMPanther: PTHR24343:SF61
126-661 SUBFAMILY NOT NAMED

RISAYEISKTLGEGSFGKVKLAVHKGTKQMVALKIISRKRLASTDMAGRVEREIEYLQLLRHPHIIKLYTVIKTDNEIIMVLEYAGGELFDHIVTNGRLSEDEARRFFQQMLCAVEYCHRHKIVHRDLKPENLLLDDNLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEVISGKLYAGSEVDVWSCGVILYVLLVGRLPFDDDHIPTLFSKIARGTYVVPHWMSPGAAALIKKMLVVNPVNRATITEIRQDPWFTTELPEYLQPPIEPFFNTGIDPEKAIRPSDIAPNAPPKVQEKLHAEVTDKISKTMGYGKQDVLDALEAEEPSAIKDAYMIVRENKMMQSNPALGGDNPFFATTPLGDENGSTGIMETMDSAMSASGHDPNASPMTSMSVRSATSSTLSAALAYQRPYTSKIGILPSSLPAYHNAYMESEKSGTAQDVPDMMALNEPPAPARTPAEQEETARRLRPHARSSQSAADSKPQSLTPSNAPKKTKPTRWQFGIRSRNAPFEALLCIYKALKKLDCSWKIDRDYH

HMMPanther: PTHR24343
126-661 FAMILY NOT NAMED,SERINE/THREONINE KINASE

RISAYEISKTLGEGSFGKVKLAVHKGTKQMVALKIISRKRLASTDMAGRVEREIEYLQLLRHPHIIKLYTVIKTDNEIIMVLEYAGGELFDHIVTNGRLSEDEARRFFQQMLCAVEYCHRHKIVHRDLKPENLLLDDNLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEVISGKLYAGSEVDVWSCGVILYVLLVGRLPFDDDHIPTLFSKIARGTYVVPHWMSPGAAALIKKMLVVNPVNRATITEIRQDPWFTTELPEYLQPPIEPFFNTGIDPEKAIRPSDIAPNAPPKVQEKLHAEVTDKISKTMGYGKQDVLDALEAEEPSAIKDAYMIVRENKMMQSNPALGGDNPFFATTPLGDENGSTGIMETMDSAMSASGHDPNASPMTSMSVRSATSSTLSAALAYQRPYTSKIGILPSSLPAYHNAYMESEKSGTAQDVPDMMALNEPPAPARTPAEQEETARRLRPHARSSQSAADSKPQSLTPSNAPKKTKPTRWQFGIRSRNAPFEALLCIYKALKKLDCSWKIDRDYH

ProfileScan: PS50011
IPR000719
130-381 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YEISKTLGEGSFGKVKLAVHKGTKQMVALKIISRKRLASTDMAGRVEREIEYLQLLRHPHIIKLYTVIKTDNEIIMVLEYAGGELFDHIVTNGRLSEDEARRFFQQMLCAVEYCHRHKIVHRDLKPENLLLDDNLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEVISGKLYAGSEVDVWSCGVILYVLLVGRLPFDDDHIPTLFSKIARGTYVVPHWMSPGAAALIKKMLVVNPVNRATITEIRQDPWF

HMMPfam: PF00069
IPR017442
130-381 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

YEISKTLGEGSFGKVKLAVHKGTKQMVALKIISRKRLASTDMAGRVEREIEYLQLLRHPHIIKLYTVIKTDNEIIMVLEYAGGELFDHIVTNGRLSEDEARRFFQQMLCAVEYCHRHKIVHRDLKPENLLLDDNLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEVISGKLYAGSEVDVWSCGVILYVLLVGRLPFDDDHIPTLFSKIARGTYVVPHWMSPGAAALIKKMLVVNPVNRATITEIRQDPWF

HMMSmart: SM00219
IPR020635
130-379 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

YEISKTLGEGSFGKVKLAVHKGTKQMVALKIISRKRLASTDMAGRVEREIEYLQLLRHPHIIKLYTVIKTDNEIIMVLEYAGGELFDHIVTNGRLSEDEARRFFQQMLCAVEYCHRHKIVHRDLKPENLLLDDNLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEVISGKLYAGSEVDVWSCGVILYVLLVGRLPFDDDHIPTLFSKIARGTYVVPHWMSPGAAALIKKMLVVNPVNRATITEIRQDP

HMMSmart: SM00220
IPR002290
130-381 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YEISKTLGEGSFGKVKLAVHKGTKQMVALKIISRKRLASTDMAGRVEREIEYLQLLRHPHIIKLYTVIKTDNEIIMVLEYAGGELFDHIVTNGRLSEDEARRFFQQMLCAVEYCHRHKIVHRDLKPENLLLDDNLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEVISGKLYAGSEVDVWSCGVILYVLLVGRLPFDDDHIPTLFSKIARGTYVVPHWMSPGAAALIKKMLVVNPVNRATITEIRQDPWF

PatternScan: PS00107
IPR017441
136-159 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGEGSFGKVKLAVHKGTKQMVALK

Gene3D: G3DSA:1.10.510.10
228-385 no description

EARRFFQQMLCAVEYCHRHKIVHRDLKPENLLLDDNLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEVISGKLYAGSEVDVWSCGVILYVLLVGRLPFDDDHIPTLFSKIARGTYVVPHWMSPGAAALIKKMLVVNPVNRATITEIRQDPWFTTEL

PatternScan: PS00108
IPR008271
248-260 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDLKPENLLL

HMMPfam: PF08587
IPR013896
424-465 UBA_2
Ubiquitin-associated domain (UBA)

LHAEVTDKISKTMGYGKQDVLDALEAEEPSAIKDAYMIVREN

Seg: seg
522-533 seg

SATSSTLSAALA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox