PRGDB00071129 (Mgr.18860)

From PRG Wiki
Jump to: navigation, search
Mgr.18860
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145607907 (XM_001408127)
Gene Class N
Domain Type NBS
Gene Species Magnaporthe grisea

Comment?

Magnaporthe grisea 70-15 hypothetical protein (MGG_13624) partial mRNA

DNA Sequence

ATGTCTCAACCCGTGGAGGACCCGAGCCACGACCAAGCACGCAACGACAACGCGCAAACAACAACCGATACTGGCAACGCCAGCATGCCCAAAACGAACGGCCATGACCAGGAGAGCTCCGCCACCGGTATCAGCTCCTCGCCGGCCGACACGTTGATGGACAAGGAGAAACAAGCAGCACCCACACCCGAACCCTCGACCGAGAAGGCTGCCGTGCCTGACCCCGCGGCCTCGGTCGCGAGTGACACAGCCGAGGATGAGTTCTTTGATGACAACGACTCGGAGCAGAGGCGGCGGAACGAGATGGTACAGCAGCTAGCGCGCACCTACACGTCCCGATCTAACGCGTCGGCCGCCGCTGATGAATATGGCAACGCAAACCCCTTCCTGATTGCCAGCGAGGACCCGGACTCGCCCCTGAACCCGAGCGGCAACAACTTCAAGGCCTACGCCTGGGCCAAGGCCATTGCAGGCATGGTCGCGGCCGAGGGCGGTTCATTCCGTACCATTGGTATTTGCTTCCAGAACATGAACGTTTTCGGCTTTGGCGCCGCGACGGATTTCCAAAAGACCGTGTCCAACGTCTGGCTCGAGGCGGCAAACATGCTCAGGACGGCGGTGGGCATGGGCAAGACAACAAGAATTGACATCCTGCGGGGTTTCAATGGCGTGGGTTGTCGGCAGAGGAAATGCACAAACGTCACCGAGGAGAGGCAATCTACACTGCAGAAGTTGCTGTCGGTTGGGGATACCCTTACCTTTGCTGCGAACGCAAGAGCTCCCCGCAGGGGCCCTCCAGGGGTCTCCAAGACGCTCTTCGCAAACCATATTCGCGATGTTGTCATGGCAATATTCGGAATCTCACACACCATTAATACCCGCGTCGGCAATGAATATATCCGCGGTGTCTCTGGTGGCGAGAGAAAACGTGTGACCATCGCAGAAGCTGCATTGTCCGGCGCGCCCCTGCAATGTTGGGACAACAGTACCCGCGGTCTGGACAGCGCCAACGCAATCGAGTTTTGCAAGACACTCCGTCTGCAGACAAGGCTCTTCCAGACCACGGCATGCGTAAGTATCTATCAGGCACCGCAATCGGCATACGACATGTTTGATAAAGCTGTCGTTTTGTACGAAGGTTATCAGATTTACTTTGGTCCCGCCGACGAGGCCAAGCAGTACTTTGTAAACCTGGGTTTCGAGTGCCCTGCTCGCGCCACTACTCCCGATTTCTTGACTTCCATGACAGCGCCACACGAGCGTATTGTGCGTCCCGGCTTCGAGGGCAAGGCCCCGAGGACACCCGAGGAATTCGCCATCGCCTGGGAAAACAGCGCCGAATACACGGCACTTCAAGCCGACATTGAGGAGTACAAGAGTTCGCATCCTATCAACGGCCCTGATGCCGAGGCATTCCGCAAGTCCAGGGCGGCTCAGCAAGGCCGCGGTCAGAGGCCCAACAGCCCTTACACTTTGTCCTTTTACCAGCAGACCAAGCTATGCCTCTGGCGTGGATGGAAGCGTCTGCTGGGTGATCCCACCCTCACGGTCGGCGCACTGTTTGCCAATACCCTCATGGCACTGGTTATCTCGAGTATCTTCTTCAACCTGCAAATGACGACATCCAGCTTCTTCCAGCGGGGTGCTCTTCTCTTCTTTGCCTGTCTGCTCAACGGATTCGCTGCTGCTCTCGAGATCTTGATCCTCTTCGCCCAACGTCCCATTGTCGAAAAACACGATCGTTACGCCTTGTACCATCCGTCCGCAGAAGCCGTGGCCTCGATGCTTTGCGATATGCCCTACAAAGTCTTCAACGCCATCGTATTCAACCTCGTGCTCTACTTCATGGCCAATCTGCGTAGAGAACCAGGAGCGTTTTTCTTCTACCTCCTGATCTCATTTGCGACCGTTCTGGCCATGTCCATGATGTTCCGTACCATCGCTTCCATGTCTCGTTCGCTTTCTCAGGCAATGGTACCGGCTGCGGCAATCATCTTGATCCTCATCATTTTCACCGGATTCGTCATCCCGCTCGACTACATGCTGCCATGGTGTCGATGGCTCAACTACATTGACATCTTGGCATATTCTTTCGAGTCGCTGCTGATCAATGAGTTTGCCGGGCAACGTTACACCTGTACCGAGTTTGTTCCGCGAGCAGAGTTTCCCGGCTACGGTGATCTCTCGGGGACCAACAGGGTCTGTCAAGCCGTGGGCTCTGTTGCTGGTCAACCATTCGTCAAGGGTGAGGATTACCTCTACAGCTCTTTCAGGTATGAATCGGCCAACAAGTGGCGAAACTTTGGCATCCTGATTGCTTTTATGATCTTCTTCTTGTTCACGTACATGGTTGCGGCCGAGAATGTGCGAGAGAAAAAGTCCAAGGGCGAGGTGCTCGTGTTCCGCCGTGGACAAAGGCCTGCTGCTATCAAGGATGCCAAGACGGACCCCGAGGCTGGGCCACCCAAGGTTGGCGGCGCAGTTGTGGCTGCCAACATGACGGGAGAGAATGCCGGTTTCATCCAGAGGCAAACGAGCACTTTTGGTTGGAGGGATGTCTGCTATGAAGTTCAGATCAAGAAGGAGACGAGACGCATCCTTGACCACGTTGATGGTTGGGTGAAGCCCGGAACTTTGACAGCGTTGATGGGTGTTTCTGGCGCTGGAAAGACGACTCTGCTCGACTGCTTGGCAGACCGAACTTCGATGGGAGTCATCACGGGCGAAATGCTCGTAGACGGCCACCAGCGAGACGCTTCCTTCCAACGCAAAACGGGTTACGTTCAGCAGCAAGATCTCCATTTGCAAACGACGACAGTTCGTGAGGCATTGAACTTTAGTGCCCTGCTCCGCCAACCCGCCCATGTACCCCGCGCCGAAAAGCTCGCTTATGTTGACGAAGTGATCCGACTTCTTGATATGCAAGAGTATGCCGATGCTGTCGTCGGTGTCCCTGGAGAAGGTTTGAACGTAGAACAGAGGAAGCGCTTGACTATCGGAGTGGAACTCGCAGCCAAGCCCCCTCTGTTGCTATTTGTTGACGAGCCAACTTCGGGATTGGATTCGCAAACCTCATGGGCTATCCTGGACCTGCTCGAAAAGCTCACCAAGAGCGGACAAGCAATTCTCTGCACTATCCACCAGCCGTCCGCCATGCTATTCCAACGTTTCGACCGGCTCTTGTTCCTAGCCAAGGGCGGAAAAACGGTTTACTTTGGCGATATTGGCGAAAACTCCAAGATCATGACGGACTACTTTGAGCGCAATGGTGGCTTCCCCTGCCCCCACGATGCGAACCCGGCCGAATGGATGTTGGAGGTTATTGGAGCATCGCCAGGAACTACGTCAGACATCGACTGGCACCAGGCATGGCGGGAGAGTCCCGAGTGTGCCGACGTCCACGCAGAGCTGGACCGACTCAAGGAGCAGGTTCCAAACACGCCACCCCCGACTGAGGACAAAGCCAGCTACCGCGAGTTTGCAGCGCCGTTCCACCAACAGATATACGCCGTGACTCACCGTGTTTTCCAGCAGTACTGGCGCACTCCGTCCTACATATACGCCAAGGCAGCGCTCTGTGCCGTCACGGCCTTGTTCATCGGGTTTGTCTTTTACGACGCGCCCAACACACAACAAGGCCTGCAGAACCAGATGTTTGCCATCTTCAACATCCTTACAGTCTTTGGCCAGCTTGTGCAGCAGACAATGCCGCACTTTGTCATCCAGCGTGACTTGTATGAGGTCAGAGAGAGGCCGAGCAAGGTCTACTCGTGGAAGGTTTTCATGCTGTCACAGATCATCGTCGAAATCCCTTGGAACTCATTGATGGCTGTCATCATGTTCTTTTGTTGGTACTACCCCGTTGGCCTCGAGAGAAACGCCATCTTGGCCGACCAGGTCACCGAGCGCGGCGCTCTGGCATTCCTGTACCTGTGGGGTTTCTTGATCTTCACATCGACCTTTACCGACCTGATGATTGCCGGTTTCGAGACGGCCGAGGCTGGTGGCAACATTGCGAACCTGTTCTTCTCCCTTTGTCTCATCTTCTGTGGTGTGCTTGCGAACCCGGACACCATGCCGAGATTCTGGATTTTCATGTATCGCGTCTCGCCATTCACCTACATCGTGTCTGGCCTGTTATCCGTCGCCGTGGCAAACAGCGAGGTTCGGTGTGCGAGCAACGAGTTCCTTCATTTCGACCCCTTGAATGGGACATGCGCAGAGTTTATGAGAAACTACATCAACGGCACGACCATCCCCGGCTTGGGGAGAATTCCAGGCGCTGGGGGTTACCTGCGCCCGGACACGGAATCGTCGAGGTCCAACTGCGCCTTCTGCCCCATCAAGGATACCAACATCTTCCTTCAGGGCGCACACGCCAACTACAACGACCGGTGGAGGAATTTTGGGCTCATCTTTGTATACATTATTTTCAACATCATCGCCGCCCTCTTTGTATACTGGGCTGTGCGTGTGCCCAAGAAGAAGCTCGGTGGCAAGGATGCCGCTGCTGGTGTGGGTGCGGGTGCGGGCGCTGCAAGAGCGAGCGCTAGCAACGAGAAGGGCAAGATGCAACGAGAAAAGGGCGAGGTGGAGGGCCTGACGACTGCCGTTCTGGGGACGAGCGTTGCTGGCAGTGATGCGCCAATGACGACGACGACGGAGGGCGAGGGCGAAAGGGCGAAGCGGAGAACCAGTGGTGATGAAGTTGTGAGGTGA


Protein sequences

Name Description Sequence
Mgr.18860 translated coding region predicted by ESTScan from UniGene Mgr.18860

MSQPVEDPSHDQARNDNAQTTTDTGNASMPKTNGHDQESSATGISSSPADTLMDKEKQAAPTPEPSTEKAAVPDPAASVASDTAEDEFFDDNDSEQRRRNEMVQQLARTYTSRSNASAAADEYGNANPFLIASEDPDSPLNPSGNNFKAYAWAKAIAGMVAAEGGSFRTIGICFQNMNVFGFGAATDFQKTVSNVWLEAANMLRTAVGMGKTTRIDILRGFNGVGCRQRKCTNVTEERQSTLQKLLSVGDTLTFAANARAPRRGPPGVSKTLFANHIRDVVMAIFGISHTINTRVGNEYIRGVSGGERKRVTIAEAALSGAPLQCWDNSTRGLDSANAIEFCKTLRLQTRLFQTTACVSIYQAPQSAYDMFDKAVVLYEGYQIYFGPADEAKQYFVNLGFECPARATTPDFLTSMTAPHERIVRPGFEGKAPRTPEEFAIAWENSAEYTALQADIEEYKSSHPINGPDAEAFRKSRAAQQGRGQRPNSPYTLSFYQQTKLCLWRGWKRLLGDPTLTVGALFANTLMALVISSIFFNLQMTTSSFFQRGALLFFACLLNGFAAALEILILFAQRPIVEKHDRYALYHPSAEAVASMLCDMPYKVFNAIVFNLVLYFMANLRREPGAFFFYLLISFATVLAMSMMFRTIASMSRSLSQAMVPAAAIILILIIFTGFVIPLDYMLPWCRWLNYIDILAYSFESLLINEFAGQRYTCTEFVPRAEFPGYGDLSGTNRVCQAVGSVAGQPFVKGEDYLYSSFRYESANKWRNFGILIAFMIFFLFTYMVAAENVREKKSKGEVLVFRRGQRPAAIKDAKTDPEAGPPKVGGAVVAANMTGENAGFIQRQTSTFGWRDVCYEVQIKKETRRILDHVDGWVKPGTLTALMGVSGAGKTTLLDCLADRTSMGVITGEMLVDGHQRDASFQRKTGYVQQQDLHLQTTTVREALNFSALLRQPAHVPRAEKLAYVDEVIRLLDMQEYADAVVGVPGEGLNVEQRKRLTIGVELAAKPPLLLFVDEPTSGLDSQTSWAILDLLEKLTKSGQAILCTIHQPSAMLFQRFDRLLFLAKGGKTVYFGDIGENSKIMTDYFERNGGFPCPHDANPAEWMLEVIGASPGTTSDIDWHQAWRESPECADVHAELDRLKEQVPNTPPPTEDKASYREFAAPFHQQIYAVTHRVFQQYWRTPSYIYAKAALCAVTALFIGFVFYDAPNTQQGLQNQMFAIFNILTVFGQLVQQTMPHFVIQRDLYEVRERPSKVYSWKVFMLSQIIVEIPWNSLMAVIMFFCWYYPVGLERNAILADQVTERGALAFLYLWGFLIFTSTFTDLMIAGFETAEAGGNIANLFFSLCLIFCGVLANPDTMPRFWIFMYRVSPFTYIVSGLLSVAVANSEVRCASNEFLHFDPLNGTCAEFMRNYINGTTIPGLGRIPGAGGYLRPDTESSRSNCAFCPIKDTNIFLQGAHANYNDRWRNFGLIFVYIIFNIIAALFVYWAVRVPKKKLGGKDAAAGVGAGAGAARASASNEKGKMQREKGEVEGLTTAVLGTSVAGSDAPMTTTTEGEGERAKRRTSGDEVVR

Domains

Domain Start-End Description Sequence

Seg: seg
70-82 seg

AAVPDPAASVASD

ProfileScan: PS50893
IPR003439
172-404 ABC_TRANSPORTER_2
ABC transporter-like

ICFQNMNVFGFGAATDFQKTVSNVWLEAANMLRTAVGMGKTTRIDILRGFNGVGCRQRKCTNVTEERQSTLQKLLSVGDTLTFAANARAPRRGPPGVSKTLFANHIRDVVMAIFGISHTINTRVGNEYIRGVSGGERKRVTIAEAALSGAPLQCWDNSTRGLDSANAIEFCKTLRLQTRLFQTTACVSIYQAPQSAYDMFDKAVVLYEGYQIYFGPADEAKQYFVNLGFECPA

Gene3D: G3DSA:3.40.50.300
208-427 no description

GMGKTTRIDILRGFNGVGCRQRKCTNVTEERQSTLQKLLSVGDTLTFAANARAPRRGPPGVSKTLFANHIRDVVMAIFGISHTINTRVGNEYIRGVSGGERKRVTIAEAALSGAPLQCWDNSTRGLDSANAIEFCKTLRLQTRLFQTTACVSIYQAPQSAYDMFDKAVVLYEGYQIYFGPADEAKQYFVNLGFECPARATTPDFLTSMTAPHERIVRPGF

superfamily: SSF52540
208-408 P-loop containing nucleoside triphosphate hydrolases

GMGKTTRIDILRGFNGVGCRQRKCTNVTEERQSTLQKLLSVGDTLTFAANARAPRRGPPGVSKTLFANHIRDVVMAIFGISHTINTRVGNEYIRGVSGGERKRVTIAEAALSGAPLQCWDNSTRGLDSANAIEFCKTLRLQTRLFQTTACVSIYQAPQSAYDMFDKAVVLYEGYQIYFGPADEAKQYFVNLGFECPARATT

Seg: seg
255-267 seg

AANARAPRRGPPG

PatternScan: PS00211
IPR017871
303-317 ABC_TRANSPORTER_1
ABC transporter, conserved site

VSGGERKRVTIAEAA

HMMPanther: PTHR19241
332-1502 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

GLDSANAIEFCKTLRLQTRLFQTTACVSIYQAPQSAYDMFDKAVVLYEGYQIYFGPADEAKQYFVNLGFECPARATTPDFLTSMTAPHERIVRPGFEGKAPRTPEEFAIAWENSAEYTALQADIEEYKSSHPINGPDAEAFRKSRAAQQGRGQRPNSPYTLSFYQQTKLCLWRGWKRLLGDPTLTVGALFANTLMALVISSIFFNLQMTTSSFFQRGALLFFACLLNGFAAALEILILFAQRPIVEKHDRYALYHPSAEAVASMLCDMPYKVFNAIVFNLVLYFMANLRREPGAFFFYLLISFATVLAMSMMFRTIASMSRSLSQAMVPAAAIILILIIFTGFVIPLDYMLPWCRWLNYIDILAYSFESLLINEFAGQRYTCTEFVPRAEFPGYGDLSGTNRVCQAVGSVAGQPFVKGEDYLYSSFRYESANKWRNFGILIAFMIFFLFTYMVAAENVREKKSKGEVLVFRRGQRPAAIKDAKTDPEAGPPKVGGAVVAANMTGENAGFIQRQTSTFGWRDVCYEVQIKKETRRILDHVDGWVKPGTLTALMGVSGAGKTTLLDCLADRTSMGVITGEMLVDGHQRDASFQRKTGYVQQQDLHLQTTTVREALNFSALLRQPAHVPRAEKLAYVDEVIRLLDMQEYADAVVGVPGEGLNVEQRKRLTIGVELAAKPPLLLFVDEPTSGLDSQTSWAILDLLEKLTKSGQAILCTIHQPSAMLFQRFDRLLFLAKGGKTVYFGDIGENSKIMTDYFERNGGFPCPHDANPAEWMLEVIGASPGTTSDIDWHQAWRESPECADVHAELDRLKEQVPNTPPPTEDKASYREFAAPFHQQIYAVTHRVFQQYWRTPSYIYAKAALCAVTALFIGFVFYDAPNTQQGLQNQMFAIFNILTVFGQLVQQTMPHFVIQRDLYEVRERPSKVYSWKVFMLSQIIVEIPWNSLMAVIMFFCWYYPVGLERNAILADQVTERGALAFLYLWGFLIFTSTFTDLMIAGFETAEAGGNIANLFFSLCLIFCGVLANPDTMPRFWIFMYRVSPFTYIVSGLLSVAVANSEVRCASNEFLHFDPLNGTCAEFMRNYINGTTIPGLGRIPGAGGYLRPDTESSRSNCAFCPIKDTNIFLQGAHANYNDRWRNFGLIFVYIIFNIIAALFVYWAVRVPKKKLGGKDA

HMMPanther: PTHR19241:SF15
332-1502 ATP-BINDING CASSETTE TRANSPORTER (PDR),ATP-BINDING CASSETTE TRANSPORTER (PDR)

GLDSANAIEFCKTLRLQTRLFQTTACVSIYQAPQSAYDMFDKAVVLYEGYQIYFGPADEAKQYFVNLGFECPARATTPDFLTSMTAPHERIVRPGFEGKAPRTPEEFAIAWENSAEYTALQADIEEYKSSHPINGPDAEAFRKSRAAQQGRGQRPNSPYTLSFYQQTKLCLWRGWKRLLGDPTLTVGALFANTLMALVISSIFFNLQMTTSSFFQRGALLFFACLLNGFAAALEILILFAQRPIVEKHDRYALYHPSAEAVASMLCDMPYKVFNAIVFNLVLYFMANLRREPGAFFFYLLISFATVLAMSMMFRTIASMSRSLSQAMVPAAAIILILIIFTGFVIPLDYMLPWCRWLNYIDILAYSFESLLINEFAGQRYTCTEFVPRAEFPGYGDLSGTNRVCQAVGSVAGQPFVKGEDYLYSSFRYESANKWRNFGILIAFMIFFLFTYMVAAENVREKKSKGEVLVFRRGQRPAAIKDAKTDPEAGPPKVGGAVVAANMTGENAGFIQRQTSTFGWRDVCYEVQIKKETRRILDHVDGWVKPGTLTALMGVSGAGKTTLLDCLADRTSMGVITGEMLVDGHQRDASFQRKTGYVQQQDLHLQTTTVREALNFSALLRQPAHVPRAEKLAYVDEVIRLLDMQEYADAVVGVPGEGLNVEQRKRLTIGVELAAKPPLLLFVDEPTSGLDSQTSWAILDLLEKLTKSGQAILCTIHQPSAMLFQRFDRLLFLAKGGKTVYFGDIGENSKIMTDYFERNGGFPCPHDANPAEWMLEVIGASPGTTSDIDWHQAWRESPECADVHAELDRLKEQVPNTPPPTEDKASYREFAAPFHQQIYAVTHRVFQQYWRTPSYIYAKAALCAVTALFIGFVFYDAPNTQQGLQNQMFAIFNILTVFGQLVQQTMPHFVIQRDLYEVRERPSKVYSWKVFMLSQIIVEIPWNSLMAVIMFFCWYYPVGLERNAILADQVTERGALAFLYLWGFLIFTSTFTDLMIAGFETAEAGGNIANLFFSLCLIFCGVLANPDTMPRFWIFMYRVSPFTYIVSGLLSVAVANSEVRCASNEFLHFDPLNGTCAEFMRNYINGTTIPGLGRIPGAGGYLRPDTESSRSNCAFCPIKDTNIFLQGAHANYNDRWRNFGLIFVYIIFNIIAALFVYWAVRVPKKKLGGKDA

Seg: seg
344-355 seg

TLRLQTRLFQTT

HMMPfam: PF01061
IPR013525
496-706 ABC2_membrane
ABC-2 type transporter

QQTKLCLWRGWKRLLGDPTLTVGALFANTLMALVISSIFFNLQMTTSSFFQRGALLFFACLLNGFAAALEILILFAQRPIVEKHDRYALYHPSAEAVASMLCDMPYKVFNAIVFNLVLYFMANLRREPGAFFFYLLISFATVLAMSMMFRTIASMSRSLSQAMVPAAAIILILIIFTGFVIPLDYMLPWCRWLNYIDILAYSFESLLINEF

Seg: seg
560-571 seg

FAAALEILILFA

Seg: seg
661-670 seg

AAAIILILII

HMMPfam: PF06422
IPR010929
716-816 PDR_CDR
CDR ABC transporter

FVPRAEFPGYGDLSGTNRVCQAVGSVAGQPFVKGEDYLYSSFRYESANKWRNFGILIAFMIFFLFTYMVAAENVREKKSKGEVLVFRRGQRPAAIKDAKTD

ProfileScan: PS50893
IPR003439
848-1090 ABC_TRANSPORTER_2
ABC transporter-like

FGWRDVCYEVQIKKETRRILDHVDGWVKPGTLTALMGVSGAGKTTLLDCLADRTSMGVITGEMLVDGHQRDASFQRKTGYVQQQDLHLQTTTVREALNFSALLRQPAHVPRAEKLAYVDEVIRLLDMQEYADAVVGVPGEGLNVEQRKRLTIGVELAAKPPLLLFVDEPTSGLDSQTSWAILDLLEKLTKSGQAILCTIHQPSAMLFQRFDRLLFLAKGGKTVYFGDIGENSKIMTDYFERNG

Gene3D: G3DSA:3.40.50.300
859-1077 no description

IKKETRRILDHVDGWVKPGTLTALMGVSGAGKTTLLDCLADRTSMGVITGEMLVDGHQRDASFQRKTGYVQQQDLHLQTTTVREALNFSALLRQPAHVPRAEKLAYVDEVIRLLDMQEYADAVVGVPGEGLNVEQRKRLTIGVELAAKPPLLLFVDEPTSGLDSQTSWAILDLLEKLTKSGQAILCTIHQPSAMLFQRFDRLLFLAKGGKTVYFGDIGE

superfamily: SSF52540
866-1077 P-loop containing nucleoside triphosphate hydrolases

ILDHVDGWVKPGTLTALMGVSGAGKTTLLDCLADRTSMGVITGEMLVDGHQRDASFQRKTGYVQQQDLHLQTTTVREALNFSALLRQPAHVPRAEKLAYVDEVIRLLDMQEYADAVVGVPGEGLNVEQRKRLTIGVELAAKPPLLLFVDEPTSGLDSQTSWAILDLLEKLTKSGQAILCTIHQPSAMLFQRFDRLLFLAKGGKTVYFGDIGE

HMMSmart: SM00382
IPR003593
876-1067 ATPases associated with a variety of cellula,NBS
AAA+ ATPase domain

PGTLTALMGVSGAGKTTLLDCLADRTSMGVITGEMLVDGHQRDASFQRKTGYVQQQDLHLQTTTVREALNFSALLRQPAHVPRAEKLAYVDEVIRLLDMQEYADAVVGVPGEGLNVEQRKRLTIGVELAAKPPLLLFVDEPTSGLDSQTSWAILDLLEKLTKSGQAILCTIHQPSAMLFQRFDRLLFLAKGG

HMMPfam: PF01061
IPR013525
1166-1382 ABC2_membrane
ABC-2 type transporter

QQIYAVTHRVFQQYWRTPSYIYAKAALCAVTALFIGFVFYDAPNTQQGLQNQMFAIFNILTVFGQLVQQTMPHFVIQRDLYEVRERPSKVYSWKVFMLSQIIVEIPWNSLMAVIMFFCWYYPVGLERNAILADQVTERGALAFLYLWGFLIFTSTFTDLMIAGFETAEAGGNIANLFFSLCLIFCGVLANPDTMPRFWIFMYRVSPFTYIVSGLLSV

Seg: seg
1494-1517 seg

KKKLGGKDAAAGVGAGAGAARASA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox