PRGDB00071131 (Mgr.19700)

From PRG Wiki
Jump to: navigation, search
Mgr.19700
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 39974748 (XM_368765)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Magnaporthe grisea

Comment?

Magnaporthe grisea 70-15 hypothetical protein (MGG_00479) partial mRNA

DNA Sequence

ATGGCAACGAAAGCTATGCAACTCGAAGAGTGCTTCGAGCACCTGAATGTTAACGATGAGAACGACCACGGTGACAGATTGGTACAAAAGTCCAAGATCTCCATGTCTACAGCACAAATATCTCATGGCAGTTCGAGACCGAACCTGTTCAAGGTCGCCCTACAATCGCAAAGCGCAAACACAGTCACGTCGGTGACACTCCCATCCCAGGCAGCCCAACGAAAAATGGCCCCACCACCCAAGAGCAGAGAGCCCCCTTCACCCAGCAAACACAAAAAGGATTCAGTCTCGTCCAGCGTAGATGAGCTCGCGAATGAGGAAGTTGAAGCTTCGGCCCCGAGAGTACCTAAGGAATTCCACCTTGGTATGTTCGAGATCGGACGGCCTCTGGGCAAGGGAAAGTTTGGCCGTGTATACCTCGCCCGCGAGCGTACCACCGGCTTCATCTGTGCACTCAAGGTCCTGTACAAAAAGGAGCTTGAGTCTGGCAGTGTTGAAAAACAGGTCCGACGAGAAATCGAGATCCAAACAAATCTCTGCCATCCAAACATTCTGAAGATGTATGGCCATTTCCATGACAACAAACGGATATTCCTCATCCTCGAATTTGCAGGCAAAGGTGAATTGTACAAGCATTTGCGCAAAGAAAACCGCTTTCCGGAGTGGAAGGCCGCCCAATATGTCGCCCAAATGGCCAGCGCCCTCAAATACCTCCACCGGAAACACGTCATCCACCGGGATATCAAGCCCGAGAACATCCTAGTTGGCCTTCACGGGGAGCTGAAGATTTCGGATTTTGGTTGGAGCGTGCACGCTCCCAACAACCGTCGCAAGACGCTTTGTGGAACTCTCGACTATCTCCCACCAGAGATGATCAAGTCTGGCAACAAGGACAACACTTATGACGAAAAGGTTGACCTTTGGAGCTTGGGCGTGCTGACCTACGAGTTTGTCGTTGGCGAGGCGCCCTTTGAGGATACTCCGGTCATGACCCAAAGGAGGATTGCCAGGGCCGATATGACTATCCCGTCTTTCGTTAGCCCGGAGTGCCGTGATTTGATCAAGAAACTGTTGGTTCTTGACCCTGTCAAGAGGCTCTCTTTGGACGCTGTTCAAAAGCACCCTTGGATCATCAAGCACTGCGTCAAGGGCGAGCGTGCCACCAACCGCGAGAAGGGCCGCGGTAGCGACTAA


Protein sequences

Name Description Sequence
Mgr.19700 translated coding region predicted by ESTScan from UniGene Mgr.19700

MATKAMQLEECFEHLNVNDENDHGDRLVQKSKISMSTAQISHGSSRPNLFKVALQSQSANTVTSVTLPSQAAQRKMAPPPKSREPPSPSKHKKDSVSSSVDELANEEVEASAPRVPKEFHLGMFEIGRPLGKGKFGRVYLARERTTGFICALKVLYKKELESGSVEKQVRREIEIQTNLCHPNILKMYGHFHDNKRIFLILEFAGKGELYKHLRKENRFPEWKAAQYVAQMASALKYLHRKHVIHRDIKPENILVGLHGELKISDFGWSVHAPNNRRKTLCGTLDYLPPEMIKSGNKDNTYDEKVDLWSLGVLTYEFVVGEAPFEDTPVMTQRRIARADMTIPSFVSPECRDLIKKLLVLDPVKRLSLDAVQKHPWIIKHCVKGERATNREKGRGSD

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24349
26-391 PTHR24349,SERINE/THREONINE-PROTEIN KINASE

RLVQKSKISMSTAQISHGSSRPNLFKVALQSQSANTVTSVTLPSQAAQRKMAPPPKSREPPSPSKHKKDSVSSSVDELANEEVEASAPRVPKEFHLGMFEIGRPLGKGKFGRVYLARERTTGFICALKVLYKKELESGSVEKQVRREIEIQTNLCHPNILKMYGHFHDNKRIFLILEFAGKGELYKHLRKENRFPEWKAAQYVAQMASALKYLHRKHVIHRDIKPENILVGLHGELKISDFGWSVHAPNNRRKTLCGTLDYLPPEMIKSGNKDNTYDEKVDLWSLGVLTYEFVVGEAPFEDTPVMTQRRIARADMTIPSFVSPECRDLIKKLLVLDPVKRLSLDAVQKHPWIIKHCVKGERATNRE

HMMPanther: PTHR24349:SF49
26-391 PTHR24349:SF49

RLVQKSKISMSTAQISHGSSRPNLFKVALQSQSANTVTSVTLPSQAAQRKMAPPPKSREPPSPSKHKKDSVSSSVDELANEEVEASAPRVPKEFHLGMFEIGRPLGKGKFGRVYLARERTTGFICALKVLYKKELESGSVEKQVRREIEIQTNLCHPNILKMYGHFHDNKRIFLILEFAGKGELYKHLRKENRFPEWKAAQYVAQMASALKYLHRKHVIHRDIKPENILVGLHGELKISDFGWSVHAPNNRRKTLCGTLDYLPPEMIKSGNKDNTYDEKVDLWSLGVLTYEFVVGEAPFEDTPVMTQRRIARADMTIPSFVSPECRDLIKKLLVLDPVKRLSLDAVQKHPWIIKHCVKGERATNRE

superfamily: SSF56112
IPR011009
110-379 Kinase_like
Protein kinase-like domain

ASAPRVPKEFHLGMFEIGRPLGKGKFGRVYLARERTTGFICALKVLYKKELESGSVEKQVRREIEIQTNLCHPNILKMYGHFHDNKRIFLILEFAGKGELYKHLRKENRFPEWKAAQYVAQMASALKYLHRKHVIHRDIKPENILVGLHGELKISDFGWSVHAPNNRRKTLCGTLDYLPPEMIKSGNKDNTYDEKVDLWSLGVLTYEFVVGEAPFEDTPVMTQRRIARADMTIPSFVSPECRDLIKKLLVLDPVKRLSLDAVQKHPWIIK

Gene3D: G3DSA:3.30.200.20
117-231 G3DSA:3.30.200.20

KEFHLGMFEIGRPLGKGKFGRVYLARERTTGFICALKVLYKKELESGSVEKQVRREIEIQTNLCHPNILKMYGHFHDNKRIFLILEFAGKGELYKHLRKENRFPEWKAAQYVAQM

HMMPfam: PF00069
IPR017442
124-377 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

FEIGRPLGKGKFGRVYLARERTTGFICALKVLYKKELESGSVEKQVRREIEIQTNLCHPNILKMYGHFHDNKRIFLILEFAGKGELYKHLRKENRFPEWKAAQYVAQMASALKYLHRKHVIHRDIKPENILVGLHGELKISDFGWSVHAPNNRRKTLCGTLDYLPPEMIKSGNKDNTYDEKVDLWSLGVLTYEFVVGEAPFEDTPVMTQRRIARADMTIPSFVSPECRDLIKKLLVLDPVKRLSLDAVQKHPWI

ProfileScan: PS50011
IPR000719
124-377 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FEIGRPLGKGKFGRVYLARERTTGFICALKVLYKKELESGSVEKQVRREIEIQTNLCHPNILKMYGHFHDNKRIFLILEFAGKGELYKHLRKENRFPEWKAAQYVAQMASALKYLHRKHVIHRDIKPENILVGLHGELKISDFGWSVHAPNNRRKTLCGTLDYLPPEMIKSGNKDNTYDEKVDLWSLGVLTYEFVVGEAPFEDTPVMTQRRIARADMTIPSFVSPECRDLIKKLLVLDPVKRLSLDAVQKHPWI

HMMSmart: SM00220
IPR002290
124-377 S_TKc
Serine/threonine-protein kinase domain

FEIGRPLGKGKFGRVYLARERTTGFICALKVLYKKELESGSVEKQVRREIEIQTNLCHPNILKMYGHFHDNKRIFLILEFAGKGELYKHLRKENRFPEWKAAQYVAQMASALKYLHRKHVIHRDIKPENILVGLHGELKISDFGWSVHAPNNRRKTLCGTLDYLPPEMIKSGNKDNTYDEKVDLWSLGVLTYEFVVGEAPFEDTPVMTQRRIARADMTIPSFVSPECRDLIKKLLVLDPVKRLSLDAVQKHPWI

PatternScan: PS00107
IPR017441
130-153 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGKGKFGRVYLARERTTGFICALK

Gene3D: G3DSA:1.10.510.10
232-379 G3DSA:1.10.510.10

ASALKYLHRKHVIHRDIKPENILVGLHGELKISDFGWSVHAPNNRRKTLCGTLDYLPPEMIKSGNKDNTYDEKVDLWSLGVLTYEFVVGEAPFEDTPVMTQRRIARADMTIPSFVSPECRDLIKKLLVLDPVKRLSLDAVQKHPWIIK

PatternScan: PS00108
IPR008271
243-255 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHRDIKPENILV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox