PRGDB00071132 (Mgr.19949)

From PRG Wiki
Jump to: navigation, search
Mgr.19949
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 39969600 (XM_366191)
Gene Class N
Domain Type NBS
Gene Species Magnaporthe grisea

Comment?

Magnaporthe grisea 70-15 hypothetical protein (MGG_10410) partial mRNA

DNA Sequence

ATGTCGGAAAATAAACAAACTCAAGACGGTCACCCAGTCGGGGCACACGCCAGAAATAATGACCCAACCGATGCCACCGAGGCTGCAGGAGAGCTTGCGACGCAGGGAAAGACACTCGACGCTCCCGAGGAGGATGCGATATCCATCATGGACAGGGAAACCCCTGGCAACCGTATGATGCATGCCGAAAATGAAAAGTCTAGGCCAGCCTTGTACGACGCCCAGCATCTTTCCTTGGCCGACGTGCAGCAGGTCGATGTGCAGATTCGTGACTTGCGGGTCTCTGTCGACACCTCGCCTTCGATATGGGACCCATCAACTTACATGGACCTGGCCAAGCAGACCTTTGCCAGCAGCAAGTCCCAAGGCTCCAACCATGTCAAGGCGCTGCTCCAGTCCGTCTCAGCGTCCCTTGCGCCTGGGACTCTGACTGCAATTATTGGTGGCAGTGGTTCCGGCAAGACGACCATGCTGAACACGCTTGCCGAGCGGGTTTCCAGTTCTCGACTGTCGGTGGGCGGAAGCGTCGCCTTCCGCAACGTCAGCGGAGGACAAGGCCTCGACGCTCCGGGCGGGGACATACAGTCGGTCCGGTATTCATATGTCATGCAGCAGGACATTCTGCTTCCCACGCTGACGGTCCGCGAGACGCTGCGGTACTCGGCCGACCTGCGACTGCCGCCGTCGACGACGATCGAGGAGCGCATGCGGGTGGTGGAGGAGGTTATTCTGGAGCTGGGCCTGAAGGAATGTGCAGACACCAGGATCGGAGACCATGCGCACAAGGGCTGCTCTGGCGGAGAGAAGAGGAGGGTGAGCATCGGTGTGCAGCTGCTCTCGAACCCGTCGGTCTTGTTTCTCGACGAGCCCACCACCGGACTCGACAGCACATCGGCATTCCAGCTCGTGCGGACCCTGAAGACGCTCGCGGAGAAGGGGCGGACCATCATCACGACCATCCATCAGCCGCGGGCCGAGATCTGGGAGCTCTTTGATAATCTCGTCGTCTTGACCAAGGGAAGCCCCGTCTTCTCGGGTCCGGCCAACGAGTGCGCCCCTTGGTTTGCCGATCTCGGCTACGAGCTCCCGCCGTTTGTGAACCCCTGCGAGTTCTTCATCGACATCTCGGCCGTGGACAACAGAACACCCGAGATTGAGGAGGAGACGACCACCCGGGTGTCCAATCTCAAGGCGGCCTGGAATCAAGAGTCGAGCCGCCGCTACCCTCCCGCGTCGGCCGGGACGCAGGTCACATCCCGCAAGGCCAAGTCCGAGGCGCGGAAGCATGCTTCGTTCCTGCGCCAGGTCCACGTCCTCAGCGACCGGACCTTCAAGGTCACGTACCGCGACCCCATGGGCATGGCGGCCTCGATCGTCGAGGCCATCCTGATGGGTCTCTGCACCGGCTATCTCTTCTACGACCTGGGGAGGGATCAGTCGGGCATCAGGTCTCGCCAGGGAGCACTGTACACTTCGGCCGGTCTCCAAGGCTACCTGTTTCTGCTTTTTGAGGCCTACCGTCTCAGCTTGGATATTCCCACTTTTGACCGCGAGCACAACGAGGGTTGTGTCGATATAATCCCGTTTCTCCTTTCCCGAAGGCTGTCTCGCCTGCCCACCGAAGACTTTCCGGTGCCGTTCATTTTCAGTGCCATTTTCTACTTTATGGCTGGTTTCGAACGAGAAGCACACAAGTTTCTGATCTTCTTCGCCGTCAATTTCCTGAACCACTACATTGCCGTCACCTGCGCCATGGCATGCATTTCTGCGATTCGCCATTTCCCCGGAGCAAGTCTGCTTGCCAATCTCAACTACACGCTACAAAGCATGGCGTGCGGCTTCTTTATCCAGTCCAACACCATCCCCGTCTACGTTCGCTGGCTCAAATGGATCACTTATACGTTTTACGTGTTTGGCTCCCTGTGCGGAAACGAGTTTGAAGGCAATTTCTATGACTGTCCTACCAGCAACAACCGCAACGATCCAAACTGTCGCCCATACACGGGTTCGTTTATTATGAATGCGCTGGGATTCCCGAGAAACTGGGTCTGGAAGCCGATCGTCGCTCAGGTGGCCTTTGTGGTCTTCTTTTACACAACTGCTGGTCTTGGGCTGCGATTCCTAAAGACGGAAATGACAATTGCTCGGTCTCGTACCAGTGAGACGGATTTGTCCTTTGGCAAGGAGAAGATGAACGCGCGGTCCATCGCCGAGGTCAGGGCCATCGATGTCGGCCTGGACGATTTCACCCTCAACCTCGAAAAGAAGACGGCCCTGGGCAAGAAGCTGCCGACCAAGGTCATTCTCAACCCCGTGACCACGACGTTCAGGTCAGGGCAGATCAACGTCATCATGGGCCCCTCCGGGTCTGGCAAAACCTCGCTGCTCAACGCCATGGCTCTTCGACTGCGCAACACGATTGGCACAAAGTACCGACGCTCCGGCAAGCTCTCGTTCAACGGTGCTGAACCGTCCGATGCCGTCATCCGGTCCGTGTGCTCGTACGTGTCTCAGGACGACGATGCTCTTTTGCCCAGCCTGACGGTGCGCGAAACTCTGCGCTTTTCTGCCGGGCTGAGACTCCCGTCGTGGATGAGCAAGGAGGAAAAGAACAAGCGGGCCGAGGAGGTGCTGCTCAAGATGGGTCTCAAGGACTGCGCCGACAACCTCGTGGGCAACGATCTCATCAAGGGTATCAGCGGTGGAGAGAAGCGTCGCGTCACCATCGCCATCCAGATCCTCACCGACCCTCGAGTCCTTCTACTTGACGAGCCAACGAGCGGTCTGGATGCCTTTACGACCTTGTCACTGATGGAGCTGTTTGCCGGGTTGGCCAGCGAAGGGAGGACGTTGATCCTGACCATCCACCAGGCTCGGTCGGACCTTTTCCAGCAGTTTGGTAATGTTTTGCTTCTGGCACGAGGTGGCTCTCCCGTCTACTCGGGGCCGGCAGGACAGATGGTGGAGTACTTTGCCCGCCATGGATACCGCTGCCCGGTCAACAACAACCCGGCCGACTACGCTCTGGATCTCATCACCATTGACCTGCAGCACGCCGAGAGGGAAGCTGCCAGCAGGGAAAAGGTTCAGAGGCTGGTGGAGGGATGGAAGACGTTTGCCGAGGAGCAGACCCGACGTGAACTGGAGCAGGAGAACAAGGAAAAGACAGGCGGCACTGCCGGCGGAGTACTCGCCTCGTATCCCACCAGGCTGTCTGATATCCGCGAAGCCGAGGAGCCAAGATCCCCCTCCGAGTCTGGTGCGCCGCCTTGGCGCGATCAAACAACCGCCCGACCCGACGCGGGCCTGTTCTCGGCCGCATCGCGCCGGTCTTTGCACAAGTCCAAGCTTGCCACGCCGGCCGAGCTGGGCGCCATGGTGCGCAAGCGAGCGGGCTTCTTCACGGCGTTCCCGATCCTGATGCGCCGCGCCGTGGTCAACTTTCGCCGGCAGCCGCCGCTGCTCGTGGCCCGCCTGATGCAGGTCCTCGGGCTCGGCATCATCCTGACGCTCTTCTTCGCGCCGCTCAAGTCGGACTACTTTTCCGTCCAGAACCGGGCCGGCTTCATCCAGGAGGTTGCCGCGTTTTACTTTGTCGGCATGCTGCAAAACGTGGCCGTCTACCCGGCGGAGCGCAACTGCTTCTACGCCGAGGACGACGACGGCGTCTACAGCGTCGAGGCCTTCCTCGCCACCTACACGCTCCTGGAGCTGCCCTTTGAGCTGCTGAGCTGCATGTTGTTTGGTGTCATGGCCGTCTTTGCCGTCGGCCTCCCGCACACGGCCGAGATGTATTTCGTCTGCACCTTTGTCTGCTGGGGTATCGTGAGCTGTGGCGAAAGCTTGGGCATGATGTTCAACACTTTGTTTTCCAATCACACTGGGTTTGCCATTACCCTGACTAGCGTTTTCCTCAGCATCTCAAACGCCATGGGAGGAATCATGTCCATCGACATGCCGGCCATCTACGACGCCTTTAACCACATCAGCCCCGTCCGCTTCGCCGTCTTGGCACTGGCGCCCTACACGCTCAGGGGCGTCCAGTTCTCGTGCGAGGCCTCGCAACGTCTCCCCAACGGACGATGCATCATCTCGACGGGCGAGGACGTCTTGGATCTTTACAAGCTCAACGTCAACGGCACGCTGAATCTGGGATACCTGATGGTGCTTGCGTTTGCCTATCGCATCGCGGCCTGGGCTCTGTTGAGGGCTGTGAGGACCAAGTGGAAATGA


Protein sequences

Name Description Sequence
Mgr.19949 translated coding region predicted by ESTScan from UniGene Mgr.19949

MSENKQTQDGHPVGAHARNNDPTDATEAAGELATQGKTLDAPEEDAISIMDRETPGNRMMHAENEKSRPALYDAQHLSLADVQQVDVQIRDLRVSVDTSPSIWDPSTYMDLAKQTFASSKSQGSNHVKALLQSVSASLAPGTLTAIIGGSGSGKTTMLNTLAERVSSSRLSVGGSVAFRNVSGGQGLDAPGGDIQSVRYSYVMQQDILLPTLTVRETLRYSADLRLPPSTTIEERMRVVEEVILELGLKECADTRIGDHAHKGCSGGEKRRVSIGVQLLSNPSVLFLDEPTTGLDSTSAFQLVRTLKTLAEKGRTIITTIHQPRAEIWELFDNLVVLTKGSPVFSGPANECAPWFADLGYELPPFVNPCEFFIDISAVDNRTPEIEEETTTRVSNLKAAWNQESSRRYPPASAGTQVTSRKAKSEARKHASFLRQVHVLSDRTFKVTYRDPMGMAASIVEAILMGLCTGYLFYDLGRDQSGIRSRQGALYTSAGLQGYLFLLFEAYRLSLDIPTFDREHNEGCVDIIPFLLSRRLSRLPTEDFPVPFIFSAIFYFMAGFEREAHKFLIFFAVNFLNHYIAVTCAMACISAIRHFPGASLLANLNYTLQSMACGFFIQSNTIPVYVRWLKWITYTFYVFGSLCGNEFEGNFYDCPTSNNRNDPNCRPYTGSFIMNALGFPRNWVWKPIVAQVAFVVFFYTTAGLGLRFLKTEMTIARSRTSETDLSFGKEKMNARSIAEVRAIDVGLDDFTLNLEKKTALGKKLPTKVILNPVTTTFRSGQINVIMGPSGSGKTSLLNAMALRLRNTIGTKYRRSGKLSFNGAEPSDAVIRSVCSYVSQDDDALLPSLTVRETLRFSAGLRLPSWMSKEEKNKRAEEVLLKMGLKDCADNLVGNDLIKGISGGEKRRVTIAIQILTDPRVLLLDEPTSGLDAFTTLSLMELFAGLASEGRTLILTIHQARSDLFQQFGNVLLLARGGSPVYSGPAGQMVEYFARHGYRCPVNNNPADYALDLITIDLQHAEREAASREKVQRLVEGWKTFAEEQTRRELEQENKEKTGGTAGGVLASYPTRLSDIREAEEPRSPSESGAPPWRDQTTARPDXGPVLGRIAPVFAQVQACHAGRAGRHGAQASGLLHGVPDPDAPRRGQLSPAAAAARGPPDAGPRARHHPDALLRAAQVGLLFRPEPGRLHPEVAAFYFVGMLQNVAVYPAERNCFYAEDDDGVYSVEAFLATYTLLELPFELLSCMLFGVMAVFAVGLPHTAEMYFVCTFVCWGIVSCGESLGMMFNTLFSNHTGFAITLTSVFLSISNAMGGIMSIDMPAIYDAFNHISPVRFAVLALAPYTLRGVQFSCEASQRLPNGRCIISTGEDVLDLYKLNVNGTLNLGYLMVLAFAYRIAAWALLRAVRTKWK

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR19241
83-709 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

QQVDVQIRDLRVSVDTSPSIWDPSTYMDLAKQTFASSKSQGSNHVKALLQSVSASLAPGTLTAIIGGSGSGKTTMLNTLAERVSSSRLSVGGSVAFRNVSGGQGLDAPGGDIQSVRYSYVMQQDILLPTLTVRETLRYSADLRLPPSTTIEERMRVVEEVILELGLKECADTRIGDHAHKGCSGGEKRRVSIGVQLLSNPSVLFLDEPTTGLDSTSAFQLVRTLKTLAEKGRTIITTIHQPRAEIWELFDNLVVLTKGSPVFSGPANECAPWFADLGYELPPFVNPCEFFIDISAVDNRTPEIEEETTTRVSNLKAAWNQESSRRYPPASAGTQVTSRKAKSEARKHASFLRQVHVLSDRTFKVTYRDPMGMAASIVEAILMGLCTGYLFYDLGRDQSGIRSRQGALYTSAGLQGYLFLLFEAYRLSLDIPTFDREHNEGCVDIIPFLLSRRLSRLPTEDFPVPFIFSAIFYFMAGFEREAHKFLIFFAVNFLNHYIAVTCAMACISAIRHFPGASLLANLNYTLQSMACGFFIQSNTIPVYVRWLKWITYTFYVFGSLCGNEFEGNFYDCPTSNNRNDPNCRPYTGSFIMNALGFPRNWVWKPIVAQVAFVVFFYTTAGLGLRFLK

ProfileScan: PS50893
IPR003439
106-364 ABC_TRANSPORTER_2
ABC transporter-like

STYMDLAKQTFASSKSQGSNHVKALLQSVSASLAPGTLTAIIGGSGSGKTTMLNTLAERVSSSRLSVGGSVAFRNVSGGQGLDAPGGDIQSVRYSYVMQQDILLPTLTVRETLRYSADLRLPPSTTIEERMRVVEEVILELGLKECADTRIGDHAHKGCSGGEKRRVSIGVQLLSNPSVLFLDEPTTGLDSTSAFQLVRTLKTLAEKGRTIITTIHQPRAEIWELFDNLVVLTKGSPVFSGPANECAPWFADLGYELPP

Gene3D: G3DSA:3.40.50.300
124-350 no description

SNHVKALLQSVSASLAPGTLTAIIGGSGSGKTTMLNTLAERVSSSRLSVGGSVAFRNVSGGQGLDAPGGDIQSVRYSYVMQQDILLPTLTVRETLRYSADLRLPPSTTIEERMRVVEEVILELGLKECADTRIGDHAHKGCSGGEKRRVSIGVQLLSNPSVLFLDEPTTGLDSTSAFQLVRTLKTLAEKGRTIITTIHQPRAEIWELFDNLVVLTKGSPVFSGPANE

superfamily: SSF52540
128-350 P-loop containing nucleoside triphosphate hydrolases

KALLQSVSASLAPGTLTAIIGGSGSGKTTMLNTLAERVSSSRLSVGGSVAFRNVSGGQGLDAPGGDIQSVRYSYVMQQDILLPTLTVRETLRYSADLRLPPSTTIEERMRVVEEVILELGLKECADTRIGDHAHKGCSGGEKRRVSIGVQLLSNPSVLFLDEPTTGLDSTSAFQLVRTLKTLAEKGRTIITTIHQPRAEIWELFDNLVVLTKGSPVFSGPANE

HMMSmart: SM00382
IPR003593
140-341 ATPases associated with a variety of cellula,NBS
AAA+ ATPase domain

PGTLTAIIGGSGSGKTTMLNTLAERVSSSRLSVGGSVAFRNVSGGQGLDAPGGDIQSVRYSYVMQQDILLPTLTVRETLRYSADLRLPPSTTIEERMRVVEEVILELGLKECADTRIGDHAHKGCSGGEKRRVSIGVQLLSNPSVLFLDEPTTGLDSTSAFQLVRTLKTLAEKGRTIITTIHQPRAEIWELFDNLVVLTKGS

HMMPfam: PF00005
IPR003439
155-292 ABC_tran
ABC transporter-like

TTMLNTLAERVSSSRLSVGGSVAFRNVSGGQGLDAPGGDIQSVRYSYVMQQDILLPTLTVRETLRYSADLRLPPSTTIEERMRVVEEVILELGLKECADTRIGDHAHKGCSGGEKRRVSIGVQLLSNPSVLFLDEPTT

Seg: seg
164-176 seg

RVSSSRLSVGGSV

Seg: seg
232-246 seg

IEERMRVVEEVILEL

PatternScan: PS00211
IPR017871
264-278 ABC_TRANSPORTER_1
ABC transporter, conserved site

CSGGEKRRVSIGVQL

Seg: seg
382-391 seg

TPEIEEETTT

HMMPfam: PF01061
IPR013525
434-646 ABC2_membrane
ABC-2 type transporter

RQVHVLSDRTFKVTYRDPMGMAASIVEAILMGLCTGYLFYDLGRDQSGIRSRQGALYTSAGLQGYLFLLFEAYRLSLDIPTFDREHNEGCVDIIPFLLSRRLSRLPTEDFPVPFIFSAIFYFMAGFEREAHKFLIFFAVNFLNHYIAVTCAMACISAIRHFPGASLLANLNYTLQSMACGFFIQSNTIPVYVRWLKWITYTFYVFGSLCGNEF

Seg: seg
530-538 seg

LLSRRLSRL

superfamily: SSF52540
681-808 P-loop containing nucleoside triphosphate hydrolases

NWVWKPIVAQVAFVVFFYTTAGLGLRFLKTEMTIARSRTSETDLSFGKEKMNARSIAEVRAIDVGLDDFTLNLEKKTALGKKLPTKVILNPVTTTFRSGQINVIMGPSGSGKTSLLNAMALRLRNTIG

ProfileScan: PS50893
IPR003439
739-1000 ABC_TRANSPORTER_2
ABC transporter-like

VRAIDVGLDDFTLNLEKKTALGKKLPTKVILNPVTTTFRSGQINVIMGPSGSGKTSLLNAMALRLRNTIGTKYRRSGKLSFNGAEPSDAVIRSVCSYVSQDDDALLPSLTVRETLRFSAGLRLPSWMSKEEKNKRAEEVLLKMGLKDCADNLVGNDLIKGISGGEKRRVTIAIQILTDPRVLLLDEPTSGLDAFTTLSLMELFAGLASEGRTLILTIHQARSDLFQQFGNVLLLARGGSPVYSGPAGQMVEYFARHGYRCPV

superfamily: SSF52540
759-986 P-loop containing nucleoside triphosphate hydrolases

LGKKLPTKVILNPVTTTFRSGQINVIMGPSGSGKTSLLNAMALRLRNTIGTKYRRSGKLSFNGAEPSDAVIRSVCSYVSQDDDALLPSLTVRETLRFSAGLRLPSWMSKEEKNKRAEEVLLKMGLKDCADNLVGNDLIKGISGGEKRRVTIAIQILTDPRVLLLDEPTSGLDAFTTLSLMELFAGLASEGRTLILTIHQARSDLFQQFGNVLLLARGGSPVYSGPAGQ

Gene3D: G3DSA:3.40.50.300
759-1009 no description

LGKKLPTKVILNPVTTTFRSGQINVIMGPSGSGKTSLLNAMALRLRNTIGTKYRRSGKLSFNGAEPSDAVIRSVCSYVSQDDDALLPSLTVRETLRFSAGLRLPSWMSKEEKNKRAEEVLLKMGLKDCADNLVGNDLIKGISGGEKRRVTIAIQILTDPRVLLLDEPTSGLDAFTTLSLMELFAGLASEGRTLILTIHQARSDLFQQFGNVLLLARGGSPVYSGPAGQMVEYFARHGYRCPVNNNPADYAL

HMMSmart: SM00382
IPR003593
778-985 ATPases associated with a variety of cellula,NBS
AAA+ ATPase domain

SGQINVIMGPSGSGKTSLLNAMALRLRNTIGTKYRRSGKLSFNGAEPSDAVIRSVCSYVSQDDDALLPSLTVRETLRFSAGLRLPSWMSKEEKNKRAEEVLLKMGLKDCADNLVGNDLIKGISGGEKRRVTIAIQILTDPRVLLLDEPTSGLDAFTTLSLMELFAGLASEGRTLILTIHQARSDLFQQFGNVLLLARGGSPVYSGPAG

HMMPfam: PF00005
IPR003439
793-927 ABC_tran
ABC transporter-like

TSLLNAMALRLRNTIGTKYRRSGKLSFNGAEPSDAVIRSVCSYVSQDDDALLPSLTVRETLRFSAGLRLPSWMSKEEKNKRAEEVLLKMGLKDCADNLVGNDLIKGISGGEKRRVTIAIQILTDPRVLLLDEPTS

PatternScan: PS00211
IPR017871
899-913 ABC_TRANSPORTER_1
ABC transporter, conserved site

ISGGEKRRVTIAIQI

Seg: seg
1075-1090 seg

REAEEPRSPSESGAPP

Seg: seg
1116-1130 seg

QACHAGRAGRHGAQA

Seg: seg
1150-1166 seg

PAAAAARGPPDAGPRAR

HMMPfam: PF01061
IPR013525
1195-1338 ABC2_membrane
ABC-2 type transporter

AFYFVGMLQNVAVYPAERNCFYAEDDDGVYSVEAFLATYTLLELPFELLSCMLFGVMAVFAVGLPHTAEMYFVCTFVCWGIVSCGESLGMMFNTLFSNHTGFAITLTSVFLSISNAMGGIMSIDMPAIYDAFNHISPVRFAVLA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox