PRGDB00071133 (Mgr.20447)

From PRG Wiki
Jump to: navigation, search
Mgr.20447
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145607236 (XM_361626)
Gene Class N
Domain Type Ser-Thr Kinase, NBS
Gene Species Magnaporthe grisea

Comment?

Magnaporthe grisea 70-15 hypothetical protein (MGG_04100) partial mRNA

DNA Sequence

ATGACACCCCCGGGAGGCTTTGCCGAGCGGGCGTACAGCGGCAGCAATGGCAAGGCGGTGGCCAGCAGCAGCGTCAGCAACAGCGGAGGTAGCAGGACTCCGGGAACGCCCAGGAAGAATTCCACGGCCAATCTGGCGAGGGAGAAGGCGCTTCAGGACCCAGGATTGAGGGACTACCGTCTCGGAGACTGCATAGGCAAGGGCGCATTCGGTTCTGTGTACAAGGCCTTCAATTGGGGAACCGGGGAGGCAGTTGCCGTCAAGCAGATCAAGTTGGTAGATGTGCCGAGGAGTGAACTCCGGATGATCGAGGCCGAAATCGATCTTCTCAAGAACCTACATGTAAGGCTGGCGCATACTCTCCGTAGAGGCAGCAAGAATGGGACCTCGGACTGCCTAAACATCATCCTCGAGTATTGCGAAAATGGATCGTTGCATTCTATCTGCAAAGCCTACGGCAAATTCCCAGAAAATCTTGTGGGGGTGTATATGACGCAGGTTCTCCAGGGTTTGCAGTACCTCCATGACCAGGGTGTCATACATCGCGATATCAAAGGGGCCAACATACTTACTACCAAAGATGGCAAAGTCAAACTGGCCGACTTTGGCGTGTCCACAAGCACGCTCGCCGGACCTGACAAGGAGGCTCAGGTTGTCGGCACCCCTTACTGGATGGCTCCAGAGATCATTCAACTCTCCGGAGCGACTTCGGCCTCTGACATCTGGAGCGTGGGATGTACAGTGATCGAGTTACTGCAGGGGAAGCCTCCGTATCATAACCTCGCACCCATGCCCGCATTATTTGCTATTGTCAACGACGATCACCCGCCGCTCCCCGAAGGAGTGTCTCCTGCTGCGCGTGACTTCCTGATGCAATGCTTCCAGAAAGACCCCAATCTCAGAGTGTCGGCAAAGAAACTGCAGAGACACCCATGGATTGTTGGCTCCAGGAGAAGCGATGCGCCCGTATCAAAAGCCCCGTCCAATTTTAGCGAAGCTGTCGAGGAGGTCAAGCAGTGGAACAAGGCATTAAAGTCATCAGAACATGGCTTAAGGGTGTCTATCGGCCCCGACGGTGCCCACCATTCGGGAAGCAACGGCACCAAGGGAACAACCGTGGATGGTCACCGGTTGAACGTAATCACGAACATCAAGGGCCCACTGACGTTAGCTAAGCCCAGACCGATGGCTGATGCCTTTAGGTCTCCTGAGATACCTGACAACGACAACTGGGACAACGATTTTGCAACAGCAATCTCACCAAGCGCACTGCATTTACCACATCTCAAACCTCAGGACAACTTTGGTGGCCTGTTATCATCGGACAGACTCAAGGCTTTTGCTTCTATCGACGACAGCAGGAACCTGTCGGCCGACTGGGATGATGATCTGGGGGGAAGTGAACAGCTCGTGACCATCAAGGCACCTCGAGCACAGCTCTCTGATCCTGACATGCAACAAACAATCCGGCCCACTCCACGGAAGAATGATCATTCTGAAAAACGCGAGAAGAAAGCATCGCTCCCTGACTTCAAACTGCAACAGCCAAACAAGACGAAGCAGAGCCGAACCTCAGCCAAGTCACCAACAAAACCGCATTTCCCAGCAAAATTCACCATACCGCCGCGGCCAGAGTCCATGTTTCGAGAGCATTCTGTCGAGGACTACTCGGACATTCTGGAGGACAACGATCACGTATTTGCCGAAAAGATGGGACTAGTGCCAAAAGACAGCCCTCAGCTCTTTCATCCCTCAGACCTGACCAGCTTGCCTCGGTCCATGCAACCTCCCAATGGTGGCAGCGTGCGGCGAGCTGCTCAACCGAGGCCTTCAGTTCTTCCAGACAGGAATATGCGGAGGACGCGGTCGTCAATAGAGATACAGCGATTCGCCGAGAACGAGAGCGACGAGGACTTTTCGGACATCTTTGGCCCAAGCGATACGCTTACCGAGAGGGACGAAAGCGACCGGGGCTCCGAGGACGGCGGCACTGGTGGTGGCAGAATGATCTTGTCCAAGTTGTCCAACAACTCATGGCTGGGCGACGACGAGGATGAGGATGATCCTTTTGCGCTGTTGGATCCTGGATGGGACGAAATGGACCTCGAGGCAAACATTGCCAGAGATCGCCATGCGAGACTATCACACAAGGTAGAGGAGCTTGTGCGGTCCTTGAAAACGACGGAGGGTGAGGACACCCTATTAGTAGTGTCTGAAGAGTTGTTGAGTCTTCTGTGGGAGAACGGGGACGTCAAAGATCTCATCATCAGCGCCCATGGCCTTTTACCTATCCTTGAAATCCTCGAGCCCTGTACGGTCAAGAGCCGACAGCATATGATCTTGCAGCTGCTCAAAATTGTCAATGCAATTATCCTTGATGATGTTGAGCTCCAAGAAAATCTTTGCTTCGTAGGAGGCATCCCCATCATCACCAAGTTTGCAGCCAGGCAGTACTCCAACGAGATACGGCTAGAAGCTGCGGCTTTCGTCAGGCAGATGTATCAAACCTCAACCCTGACGCTACAGATGTTCGTCAGCGCTGGTGGTCTGAACGTCCTTGTTGAGTTCCTCGATGAGGACTATGACGCATCAAGGGACCTGGTTCTCATTGGCGTTAATGGCATTTGGAACGTATTTGAGCTTCAGGGTCCGACGCCCAAGAACGACTTCTGTAGGATCTTTTCTCGCAGCAAGATTCTGGACCCGCTCGCTCTCGTCCTTCACAAGGTATTGGATGAGGATGACAAGAGCGAGCTGACTGAGCTCGTCGAAGGCCGCATTGTCAACATTTTCTACCTGTTTTCACAGGCGGAAAATTATGTCAAGGAGGTTGTCGCAGAGAGACAGGTCTTAAAGACTGTGCTCAGAGACCTCCGCCGCATGTCACCGATTCACCAAATCACCATGCTCAAGTTTATCAAGAACCTTTCCATGCTATCATTAACCCTAGAATCGCTCCATTCTGCTGATGCAATAGACTTCCTCATCGAACTCTTGAGCTATAGCATGAAGAAGGGTCACAAGCACTTTCGGGAGATATCAAATCAGGTGCTCAATACCATGTTCAACCTCTGCAGGCTGAGCAAAGAAAGGCAGGAGTATGCCGCCGTGAATGGCATAATACCACTCCTGCTCAAAATCATGCAAACAGACAGGCCGCCTAAAGAATTCGCTCTGCCGATTCTTTGTGACATGGCTCACTCTGGCAGCAAAGGGCGGCGCTATCTCTGGCAGAACAAGGGCCTGGACTTTTACGTTTCGTTGATCGCAGATCAGTACTGGCAGGTCAGCGCCCTCGACTCTATATCCGTCTGGCTGCAGGAGGAAACTGCCAAGGTGGAGACTCACCTATTGGACGGCAAGTTCACGGCTGCAATCACATCCTCTTTCAACAGCATCAAGACCAATGCTTTCGACTCTGGTGTCTTGGAGCCGCTGATCAAGATACTTCGACTGTCACCCTCGTTGGCGGCGTCGCTAGCCAAGTCGGAAATGTATTCGGGCCTTGCCCAGAAGCTTGGCCACAAGAAGGCCCAAGTGAGGCTTAACCTACTCCGTCTGGTGCGCAACATCATGGACGCATGTGTATCTGAAGGTGGAGGTAGCAGCATGTCAACCGCAAGCAGCGGACGCCAACTCCGCGCCCTGTTTGAGCAAATCAGGGTTCTTGCCGACAAGGATCCGGCGGTGCTGGTGCGCAATCTGGCCTCGGAACTTCTGCGCTCGCATTTGGATCCTGATGGCGTTACAAATCCCATCGGGCTAACTACATCAACTTCGGCGGTCGGCAACGGAGCAAATCCCCTTTCGTCTGCCGTGCCACCATCATCAAGCGGAGCGCCGTCTTCACGATCTCGATCCGGGCCCAGGCGCACGAGCTCATACACTCCGCCTGGGCTGTCCTCTTCAGCATCCGCGCCGCCACAGACGCCAACACATCATCAACGCCCCTCGCAATCATCAAGTATTTACACCGAAGTGGCCGTGACTGCGACGCCGCGGCGGTCAGCAGCCATAGCACAAGAGCGAGACAGCGGTGGCGTCTTTCGCCCGCGTAGCCGCGACGGACCTGGGTCGTCGGGGTCCTCGTCCTCGATACCGAGGCGTGTCAGTGGTGAGGGGGGTGCCATCCTTCTTGGTGGCAAGAACGGCGTAAGCAGTAGACTGCCGCGCACATCTAGCGCATACGGCAGACAAAGCATATCAATGGCGCAGGGACGCTCAGAGAGCTCGTCTTCAAACAAGGAAAACACAAACATTACACAAATGGGCGGTGGCAGCGACAGCAGGTATCATACACCAACCGCGGCCAACTTCGATCAGCATGATTTGGACTGGGAACGGGAGAGAGATAGGCAAAGGGGCGACAGGGCTGAGAGGGTTGCAGCCCAACAACACAAGCGGAGGAGCCGCATGACGGCCAGTTCTTCGGACATTAGGCATGGGGCACCGTCTCGATGA


Protein sequences

Name Description Sequence
Mgr.20447 translated coding region predicted by ESTScan from UniGene Mgr.20447

MTPPGGFAERAYSGSNGKAVASSSVSNSGGSRTPGTPRKNSTANLAREKALQDPGLRDYRLGDCIGKGAFGSVYKAFNWGTGEAVAVKQIKLVDVPRSELRMIEAEIDLLKNLHVRLAHTLRRGSKNGTSDCLNIILEYCENGSLHSICKAYGKFPENLVGVYMTQVLQGLQYLHDQGVIHRDIKGANILTTKDGKVKLADFGVSTSTLAGPDKEAQVVGTPYWMAPEIIQLSGATSASDIWSVGCTVIELLQGKPPYHNLAPMPALFAIVNDDHPPLPEGVSPAARDFLMQCFQKDPNLRVSAKKLQRHPWIVGSRRSDAPVSKAPSNFSEAVEEVKQWNKALKSSEHGLRVSIGPDGAHHSGSNGTKGTTVDGHRLNVITNIKGPLTLAKPRPMADAFRSPEIPDNDNWDNDFATAISPSALHLPHLKPQDNFGGLLSSDRLKAFASIDDSRNLSADWDDDLGGSEQLVTIKAPRAQLSDPDMQQTIRPTPRKNDHSEKREKKASLPDFKLQQPNKTKQSRTSAKSPTKPHFPAKFTIPPRPESMFREHSVEDYSDILEDNDHVFAEKMGLVPKDSPQLFHPSDLTSLPRSMQPPNGGSVRRAAQPRPSVLPDRNMRRTRSSIEIQRFAENESDEDFSDIFGPSDTLTERDESDRGSEDGGTGGGRMILSKLSNNSWLGDDEDEDDPFALLDPGWDEMDLEANIARDRHARLSHKVEELVRSLKTTEGEDTLLVVSEELLSLLWENGDVKDLIISAHGLLPILEILEPCTVKSRQHMILQLLKIVNAIILDDVELQENLCFVGGIPIITKFAARQYSNEIRLEAAAFVRQMYQTSTLTLQMFVSAGGLNVLVEFLDEDYDASRDLVLIGVNGIWNVFELQGPTPKNDFCRIFSRSKILDPLALVLHKVLDEDDKSELTELVEGRIVNIFYLFSQAENYVKEVVAERQVLKTVLRDLRRMSPIHQITMLKFIKNLSMLSLTLESLHSADAIDFLIELLSYSMKKGHKHFREISNQVLNTMFNLCRLSKERQEYAAVNGIIPLLLKIMQTDRPPKEFALPILCDMAHSGSKGRRYLWQNKGLDFYVSLIADQYWQVSALDSISVWLQEETAKVETHLLDGKFTAAITSSFNSIKTNAFDSGVLEPLIKILRLSPSLAASLAKSEMYSGLAQKLGHKKAQVRLNLLRLVRNIMDACVSEGGGSSMSTASSGRQLRALFEQIRVLADKDPAVLVRNLASELLRSHLDPDGVTNPIGLTTSTSAVGNGANPLSSAVPPSSSGAPSSRSRSGPRRTSSYTPPGLSSSASAPPQTPTHHQRPSQSSSIYTEVAVTATPRRSAAIAQERDSGGVFRPRSRDGPGSSGSSSSIPRRVSGEGGAILLGGKNGVSSRLPRTSSAYGRQSISMAQGRSESSSSNKENTNITQMGGGSDSRYHTPTAANFDQHDLDWERERDRQRGDRAERVAAQQHKRRSRMTASSSDIRHGAPSR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24361
3-1423 FAMILY NOT NAMED,MITOGEN-ACTIVATED KINASE KINASE KINASE

PPGGFAERAYSGSNGKAVASSSVSNSGGSRTPGTPRKNSTANLAREKALQDPGLRDYRLGDCIGKGAFGSVYKAFNWGTGEAVAVKQIKLVDVPRSELRMIEAEIDLLKNLHVRLAHTLRRGSKNGTSDCLNIILEYCENGSLHSICKAYGKFPENLVGVYMTQVLQGLQYLHDQGVIHRDIKGANILTTKDGKVKLADFGVSTSTLAGPDKEAQVVGTPYWMAPEIIQLSGATSASDIWSVGCTVIELLQGKPPYHNLAPMPALFAIVNDDHPPLPEGVSPAARDFLMQCFQKDPNLRVSAKKLQRHPWIVGSRRSDAPVSKAPSNFSEAVEEVKQWNKALKSSEHGLRVSIGPDGAHHSGSNGTKGTTVDGHRLNVITNIKGPLTLAKPRPMADAFRSPEIPDNDNWDNDFATAISPSALHLPHLKPQDNFGGLLSSDRLKAFASIDDSRNLSADWDDDLGGSEQLVTIKAPRAQLSDPDMQQTIRPTPRKNDHSEKREKKASLPDFKLQQPNKTKQSRTSAKSPTKPHFPAKFTIPPRPESMFREHSVEDYSDILEDNDHVFAEKMGLVPKDSPQLFHPSDLTSLPRSMQPPNGGSVRRAAQPRPSVLPDRNMRRTRSSIEIQRFAENESDEDFSDIFGPSDTLTERDESDRGSEDGGTGGGRMILSKLSNNSWLGDDEDEDDPFALLDPGWDEMDLEANIARDRHARLSHKVEELVRSLKTTEGEDTLLVVSEELLSLLWENGDVKDLIISAHGLLPILEILEPCTVKSRQHMILQLLKIVNAIILDDVELQENLCFVGGIPIITKFAARQYSNEIRLEAAAFVRQMYQTSTLTLQMFVSAGGLNVLVEFLDEDYDASRDLVLIGVNGIWNVFELQGPTPKNDFCRIFSRSKILDPLALVLHKVLDEDDKSELTELVEGRIVNIFYLFSQAENYVKEVVAERQVLKTVLRDLRRMSPIHQITMLKFIKNLSMLSLTLESLHSADAIDFLIELLSYSMKKGHKHFREISNQVLNTMFNLCRLSKERQEYAAVNGIIPLLLKIMQTDRPPKEFALPILCDMAHSGSKGRRYLWQNKGLDFYVSLIADQYWQVSALDSISVWLQEETAKVETHLLDGKFTAAITSSFNSIKTNAFDSGVLEPLIKILRLSPSLAASLAKSEMYSGLAQKLGHKKAQVRLNLLRLVRNIMDACVSEGGGSSMSTASSGRQLRALFEQIRVLADKDPAVLVRNLASELLRSHLDPDGVTNPIGLTTSTSAVGNGANPLSSAVPPSSSGAPSSRSRSGPRRTSSYTPPGLSSSASAPPQTPTHHQRPSQSSSIYTEVAVTATPRRSAAIAQERDSGGVFRPRSRDGPGSSGSSSSIPRRVSGEGGAILLGGKNGVSSRLPRTSSAYGRQSISMAQGRSESSSSNKENTNITQM

HMMPanther: PTHR24361:SF61
3-1423 SUBFAMILY NOT NAMED,NIK-RELATED PROTEIN KINASE

PPGGFAERAYSGSNGKAVASSSVSNSGGSRTPGTPRKNSTANLAREKALQDPGLRDYRLGDCIGKGAFGSVYKAFNWGTGEAVAVKQIKLVDVPRSELRMIEAEIDLLKNLHVRLAHTLRRGSKNGTSDCLNIILEYCENGSLHSICKAYGKFPENLVGVYMTQVLQGLQYLHDQGVIHRDIKGANILTTKDGKVKLADFGVSTSTLAGPDKEAQVVGTPYWMAPEIIQLSGATSASDIWSVGCTVIELLQGKPPYHNLAPMPALFAIVNDDHPPLPEGVSPAARDFLMQCFQKDPNLRVSAKKLQRHPWIVGSRRSDAPVSKAPSNFSEAVEEVKQWNKALKSSEHGLRVSIGPDGAHHSGSNGTKGTTVDGHRLNVITNIKGPLTLAKPRPMADAFRSPEIPDNDNWDNDFATAISPSALHLPHLKPQDNFGGLLSSDRLKAFASIDDSRNLSADWDDDLGGSEQLVTIKAPRAQLSDPDMQQTIRPTPRKNDHSEKREKKASLPDFKLQQPNKTKQSRTSAKSPTKPHFPAKFTIPPRPESMFREHSVEDYSDILEDNDHVFAEKMGLVPKDSPQLFHPSDLTSLPRSMQPPNGGSVRRAAQPRPSVLPDRNMRRTRSSIEIQRFAENESDEDFSDIFGPSDTLTERDESDRGSEDGGTGGGRMILSKLSNNSWLGDDEDEDDPFALLDPGWDEMDLEANIARDRHARLSHKVEELVRSLKTTEGEDTLLVVSEELLSLLWENGDVKDLIISAHGLLPILEILEPCTVKSRQHMILQLLKIVNAIILDDVELQENLCFVGGIPIITKFAARQYSNEIRLEAAAFVRQMYQTSTLTLQMFVSAGGLNVLVEFLDEDYDASRDLVLIGVNGIWNVFELQGPTPKNDFCRIFSRSKILDPLALVLHKVLDEDDKSELTELVEGRIVNIFYLFSQAENYVKEVVAERQVLKTVLRDLRRMSPIHQITMLKFIKNLSMLSLTLESLHSADAIDFLIELLSYSMKKGHKHFREISNQVLNTMFNLCRLSKERQEYAAVNGIIPLLLKIMQTDRPPKEFALPILCDMAHSGSKGRRYLWQNKGLDFYVSLIADQYWQVSALDSISVWLQEETAKVETHLLDGKFTAAITSSFNSIKTNAFDSGVLEPLIKILRLSPSLAASLAKSEMYSGLAQKLGHKKAQVRLNLLRLVRNIMDACVSEGGGSSMSTASSGRQLRALFEQIRVLADKDPAVLVRNLASELLRSHLDPDGVTNPIGLTTSTSAVGNGANPLSSAVPPSSSGAPSSRSRSGPRRTSSYTPPGLSSSASAPPQTPTHHQRPSQSSSIYTEVAVTATPRRSAAIAQERDSGGVFRPRSRDGPGSSGSSSSIPRRVSGEGGAILLGGKNGVSSRLPRTSSAYGRQSISMAQGRSESSSSNKENTNITQM

Seg: seg
13-31 seg

SGSNGKAVASSSVSNSGGS

superfamily: SSF56112
IPR011009
41-373 Protein kinase-like (PK-like)
Protein kinase-like domain

STANLAREKALQDPGLRDYRLGDCIGKGAFGSVYKAFNWGTGEAVAVKQIKLVDVPRSELRMIEAEIDLLKNLHVRLAHTLRRGSKNGTSDCLNIILEYCENGSLHSICKAYGKFPENLVGVYMTQVLQGLQYLHDQGVIHRDIKGANILTTKDGKVKLADFGVSTSTLAGPDKEAQVVGTPYWMAPEIIQLSGATSASDIWSVGCTVIELLQGKPPYHNLAPMPALFAIVNDDHPPLPEGVSPAARDFLMQCFQKDPNLRVSAKKLQRHPWIVGSRRSDAPVSKAPSNFSEAVEEVKQWNKALKSSEHGLRVSIGPDGAHHSGSNGTKGTTV

Gene3D: G3DSA:3.30.200.20
46-157 no description

AREKALQDPGLRDYRLGDCIGKGAFGSVYKAFNWGTGEAVAVKQIKLVDVPRSELRMIEAEIDLLKNLHVRLAHTLRRGSKNGTSDCLNIILEYCENGSLHSICKAYGKFPE

HMMPfam: PF00069
IPR017442
59-313 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

YRLGDCIGKGAFGSVYKAFNWGTGEAVAVKQIKLVDVPRSELRMIEAEIDLLKNLHVRLAHTLRRGSKNGTSDCLNIILEYCENGSLHSICKAYGKFPENLVGVYMTQVLQGLQYLHDQGVIHRDIKGANILTTKDGKVKLADFGVSTSTLAGPDKEAQVVGTPYWMAPEIIQLSGATSASDIWSVGCTVIELLQGKPPYHNLAPMPALFAIVNDDHPPLPEGVSPAARDFLMQCFQKDPNLRVSAKKLQRHPWI

ProfileScan: PS50011
IPR000719
59-313 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YRLGDCIGKGAFGSVYKAFNWGTGEAVAVKQIKLVDVPRSELRMIEAEIDLLKNLHVRLAHTLRRGSKNGTSDCLNIILEYCENGSLHSICKAYGKFPENLVGVYMTQVLQGLQYLHDQGVIHRDIKGANILTTKDGKVKLADFGVSTSTLAGPDKEAQVVGTPYWMAPEIIQLSGATSASDIWSVGCTVIELLQGKPPYHNLAPMPALFAIVNDDHPPLPEGVSPAARDFLMQCFQKDPNLRVSAKKLQRHPWI

HMMSmart: SM00219
IPR020635
59-313 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

YRLGDCIGKGAFGSVYKAFNWGTGEAVAVKQIKLVDVPRSELRMIEAEIDLLKNLHVRLAHTLRRGSKNGTSDCLNIILEYCENGSLHSICKAYGKFPENLVGVYMTQVLQGLQYLHDQGVIHRDIKGANILTTKDGKVKLADFGVSTSTLAGPDKEAQVVGTPYWMAPEIIQLSGATSASDIWSVGCTVIELLQGKPPYHNLAPMPALFAIVNDDHPPLPEGVSPAARDFLMQCFQKDPNLRVSAKKLQRHPWI

HMMSmart: SM00220
IPR002290
59-313 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YRLGDCIGKGAFGSVYKAFNWGTGEAVAVKQIKLVDVPRSELRMIEAEIDLLKNLHVRLAHTLRRGSKNGTSDCLNIILEYCENGSLHSICKAYGKFPENLVGVYMTQVLQGLQYLHDQGVIHRDIKGANILTTKDGKVKLADFGVSTSTLAGPDKEAQVVGTPYWMAPEIIQLSGATSASDIWSVGCTVIELLQGKPPYHNLAPMPALFAIVNDDHPPLPEGVSPAARDFLMQCFQKDPNLRVSAKKLQRHPWI

PatternScan: PS00107
IPR017441
65-88 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGKGAFGSVYKAFNWGTGEAVAVK

Gene3D: G3DSA:1.10.510.10
158-336 no description

NLVGVYMTQVLQGLQYLHDQGVIHRDIKGANILTTKDGKVKLADFGVSTSTLAGPDKEAQVVGTPYWMAPEIIQLSGATSASDIWSVGCTVIELLQGKPPYHNLAPMPALFAIVNDDHPPLPEGVSPAARDFLMQCFQKDPNLRVSAKKLQRHPWIVGSRRSDAPVSKAPSNFSEAVEE

PatternScan: PS00108
IPR008271
179-191 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHRDIKGANILT

Seg: seg
650-668 seg

TERDESDRGSEDGGTGGGR

Gene3D: G3DSA:1.25.10.10
IPR011989
685-1097 no description
Armadillo-like helical

DEDDPFALLDPGWDEMDLEANIARDRHARLSHKVEELVRSLKTTEGEDTLLVVSEELLSLLWENGDVKDLIISAHGLLPILEILEPCTVKSRQHMILQLLKIVNAIILDDVELQENLCFVGGIPIITKFAARQYSNEIRLEAAAFVRQMYQTSTLTLQMFVSAGGLNVLVEFLDEDYDASRDLVLIGVNGIWNVFELQGPTPKNDFCRIFSRSKILDPLALVLHKVLDEDDKSELTELVEGRIVNIFYLFSQAENYVKEVVAERQVLKTVLRDLRRMSPIHQITMLKFIKNLSMLSLTLESLHSADAIDFLIELLSYSMKKGHKHFREISNQVLNTMFNLCRLSKERQEYAAVNGIIPLLLKIMQTDRPPKEFALPILCDMAHSGSKGRRYLWQNKGLDFYVSLIADQYWQVS

superfamily: SSF48371
IPR016024
714-1154 ARM repeat,NBS
Armadillo-type fold

LSHKVEELVRSLKTTEGEDTLLVVSEELLSLLWENGDVKDLIISAHGLLPILEILEPCTVKSRQHMILQLLKIVNAIILDDVELQENLCFVGGIPIITKFAARQYSNEIRLEAAAFVRQMYQTSTLTLQMFVSAGGLNVLVEFLDEDYDASRDLVLIGVNGIWNVFELQGPTPKNDFCRIFSRSKILDPLALVLHKVLDEDDKSELTELVEGRIVNIFYLFSQAENYVKEVVAERQVLKTVLRDLRRMSPIHQITMLKFIKNLSMLSLTLESLHSADAIDFLIELLSYSMKKGHKHFREISNQVLNTMFNLCRLSKERQEYAAVNGIIPLLLKIMQTDRPPKEFALPILCDMAHSGSKGRRYLWQNKGLDFYVSLIADQYWQVSALDSISVWLQEETAKVETHLLDGKFTAAITSSFNSIKTNAFDSGVLEPLIKILRLSP

Seg: seg
734-745 seg

LLVVSEELLSLL

Seg: seg
1152-1161 seg

LSPSLAASLA

Seg: seg
1180-1190 seg

VRLNLLRLVRN

Seg: seg
1197-1210 seg

SEGGGSSMSTASSG

Seg: seg
1270-1308 seg

SSAVPPSSSGAPSSRSRSGPRRTSSYTPPGLSSSASAPP

Seg: seg
1350-1372 seg

RPRSRDGPGSSGSSSSIPRRVSG

Seg: seg
1408-1413 seg

SESSSS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox