PRGDB00071134 (Mgr.21407)

From PRG Wiki
Jump to: navigation, search
Mgr.21407
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 221863254 (DC982679)
Gene Class Unknown
Domain Type
Gene Species Magnaporthe grisea

Comment?

DC982679 Magnaporthe grisea Guy11 (NIAS) Magnaporthe grisea cDNA clone NIASMg159A03F 5', mRNA sequence

DNA Sequence

GATGGGAATGTACATCTACTGCAACTCTGATTACTACATGAACTTGACAAACTTGTGGACGAACTGGCCCAACAGGGAAGTTAGTGGGCTGATGCGCGTCTACATGCTCGCGCAACTTGCCTTTTGGTTCCAACAAATCCTCGTCATCAATATCGAGGAACGTAGGAAAGACCACTGGCAGATGTTTGCGCACCGCGTGGTTACCATCGTCCTCATTACGACGTCATGGCGCTACGGCTACACGCGTGGCGGCAACCTGATCCTCATTTTGATGGATGGAGTTGACATTGTGTTCTCTGCTGCCAAACTCTTGAAATACACGGGCTTCGACACTGCCTGTGATGTCTTTTTCGGTCTTTTCATGCTCAGCTGGGTTATCGCGCGTCACTTCGTGTACCTCACGGTTTGCTGGTCGATATAT


Protein sequences

Name Description Sequence
Mgr.21407 translated coding region predicted by ESTScan from UniGene Mgr.21407

XMGMYIYCNSDYYMNLTNLWTNWPNREVSGLMRVYMLAQLAFWFQQILVINIEERRKDHWQMFAHRVVTIVLITTSWRYGYTRGGNLILILMDGVDIVFSAAKLLKYTGFDTACDVFFGLFMLSWVIARHFVYLTVCWSIY


Domains

Domain Start-End Description Sequence

ProfileScan: PS50922
IPR006634
1-141 TLC
TRAM/LAG1/CLN8 homology domain

XMGMYIYCNSDYYMNLTNLWTNWPNREVSGLMRVYMLAQLAFWFQQILVINIEERRKDHWQMFAHRVVTIVLITTSWRYGYTRGGNLILILMDGVDIVFSAAKLLKYTGFDTACDVFFGLFMLSWVIARHFVYLTVCWSIY

HMMPfam: PF03798
IPR006634
2-140 TRAM_LAG1_CLN8
TRAM/LAG1/CLN8 homology domain

MGMYIYCNSDYYMNLTNLWTNWPNREVSGLMRVYMLAQLAFWFQQILVINIEERRKDHWQMFAHRVVTIVLITTSWRYGYTRGGNLILILMDGVDIVFSAAKLLKYTGFDTACDVFFGLFMLSWVIARHFVYLTVCWSI

HMMPanther: PTHR12560
3-141 FAMILY NOT NAMED,LONGEVITY ASSURANCE FACTOR 1 (LAG1)

GMYIYCNSDYYMNLTNLWTNWPNREVSGLMRVYMLAQLAFWFQQILVINIEERRKDHWQMFAHRVVTIVLITTSWRYGYTRGGNLILILMDGVDIVFSAAKLLKYTGFDTACDVFFGLFMLSWVIARHFVYLTVCWSIY

HMMSmart: SM00724
IPR006634
3-141 TRAM, LAG1 and CLN8 homology domains.
TRAM/LAG1/CLN8 homology domain

GMYIYCNSDYYMNLTNLWTNWPNREVSGLMRVYMLAQLAFWFQQILVINIEERRKDHWQMFAHRVVTIVLITTSWRYGYTRGGNLILILMDGVDIVFSAAKLLKYTGFDTACDVFFGLFMLSWVIARHFVYLTVCWSIY






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox