PRGDB00071135 (Mgr.23169)

From PRG Wiki
Jump to: navigation, search
Mgr.23169
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 221891852 (DC963329)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Magnaporthe grisea

Comment?

DC963329 Magnaporthe grisea Guy11 (NIAS) Magnaporthe grisea cDNA clone NIASMg039E12F 5', mRNA sequence

DNA Sequence

GGGCAGCGCTATGCGGTCAAAATATTCTCCATAGTCCCTGGTTTGGAAGAACGGTCCAGGACAGAAGGTCTCCAGCTGGAGATTGCTGTATTGATGGGCGTCAGTCATCCCAACGTGCTGTGCTTAAAGGATACCTTTCACGAGGGCAATGCAGTGTATCTGGTGCTTGAGCTGGCCCCGGAAGGTGAACTTTTCAACTTCATTGTTATGAAGCAAAAGCTTTCAGAGGCTGAGAGTCGGAAACTGTTCACCCAACTTTTCCACGGTGTCAAATACTTGCATGACCGAAACATTGTCCACCGCGATATCAAACCGGAGAACATCTTGCTGGTTGACAAGGATCTGCACGTCAAAATTGCCGATTTTGGGCTTGCCAAAATTATCGGCGAGGAGTCCTTCACGACGTCTCTGTGTGGCACGCCTAGCTACGTCGCACCCGAAATTCTCGTTGATGGCCGGCATCGCAAGTACACGAAAGCTGTTGACGTATGGTCGTTGGGCGTTGTGCTTTACATCTGCCTGTGCGGATTTC


Protein sequences

Name Description Sequence
Mgr.23169 translated coding region predicted by ESTScan from UniGene Mgr.23169

GQRYAVKIFSIVPGLEERSRTEGLQLEIAVLMGVSHPNVLCLKDTFHEGNAVYLVLELAPEGELFNFIVMKQKLSEAESRKLFTQLFHGVKYLHDRNIVHRDIKPENILLVDKDLHVKIADFGLAKIIGEESFTTSLCGTPSYVAPEILVDGRHRKYTKAVDVWSLGVVLYICLCGFX

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24344:SF26
1-177 SUBFAMILY NOT NAMED

GQRYAVKIFSIVPGLEERSRTEGLQLEIAVLMGVSHPNVLCLKDTFHEGNAVYLVLELAPEGELFNFIVMKQKLSEAESRKLFTQLFHGVKYLHDRNIVHRDIKPENILLVDKDLHVKIADFGLAKIIGEESFTTSLCGTPSYVAPEILVDGRHRKYTKAVDVWSLGVVLYICLCGF

HMMPanther: PTHR24344
1-177 FAMILY NOT NAMED,SERINE/THREONINE-PROTEIN KINASE CDS1

GQRYAVKIFSIVPGLEERSRTEGLQLEIAVLMGVSHPNVLCLKDTFHEGNAVYLVLELAPEGELFNFIVMKQKLSEAESRKLFTQLFHGVKYLHDRNIVHRDIKPENILLVDKDLHVKIADFGLAKIIGEESFTTSLCGTPSYVAPEILVDGRHRKYTKAVDVWSLGVVLYICLCGF

superfamily: SSF56112
IPR011009
1-176 Protein kinase-like (PK-like)
Protein kinase-like domain

GQRYAVKIFSIVPGLEERSRTEGLQLEIAVLMGVSHPNVLCLKDTFHEGNAVYLVLELAPEGELFNFIVMKQKLSEAESRKLFTQLFHGVKYLHDRNIVHRDIKPENILLVDKDLHVKIADFGLAKIIGEESFTTSLCGTPSYVAPEILVDGRHRKYTKAVDVWSLGVVLYICLCG

Gene3D: G3DSA:3.30.200.20
1-76 no description

GQRYAVKIFSIVPGLEERSRTEGLQLEIAVLMGVSHPNVLCLKDTFHEGNAVYLVLELAPEGELFNFIVMKQKLSE

ProfileScan: PS50011
IPR000719
1-178 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

GQRYAVKIFSIVPGLEERSRTEGLQLEIAVLMGVSHPNVLCLKDTFHEGNAVYLVLELAPEGELFNFIVMKQKLSEAESRKLFTQLFHGVKYLHDRNIVHRDIKPENILLVDKDLHVKIADFGLAKIIGEESFTTSLCGTPSYVAPEILVDGRHRKYTKAVDVWSLGVVLYICLCGFX

HMMSmart: SM00220
IPR002290
1-178 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

GQRYAVKIFSIVPGLEERSRTEGLQLEIAVLMGVSHPNVLCLKDTFHEGNAVYLVLELAPEGELFNFIVMKQKLSEAESRKLFTQLFHGVKYLHDRNIVHRDIKPENILLVDKDLHVKIADFGLAKIIGEESFTTSLCGTPSYVAPEILVDGRHRKYTKAVDVWSLGVVLYICLCGFX

HMMPfam: PF00069
IPR017442
2-176 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

QRYAVKIFSIVPGLEERSRTEGLQLEIAVLMGVSHPNVLCLKDTFHEGNAVYLVLELAPEGELFNFIVMKQKLSEAESRKLFTQLFHGVKYLHDRNIVHRDIKPENILLVDKDLHVKIADFGLAKIIGEESFTTSLCGTPSYVAPEILVDGRHRKYTKAVDVWSLGVVLYICLCG

HMMSmart: SM00219
IPR020635
5-177 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

AVKIFSIVPGLEERSRTEGLQLEIAVLMGVSHPNVLCLKDTFHEGNAVYLVLELAPEGELFNFIVMKQKLSEAESRKLFTQLFHGVKYLHDRNIVHRDIKPENILLVDKDLHVKIADFGLAKIIGEESFTTSLCGTPSYVAPEILVDGRHRKYTKAVDVWSLGVVLYICLCGF

Gene3D: G3DSA:1.10.510.10
77-176 no description

AESRKLFTQLFHGVKYLHDRNIVHRDIKPENILLVDKDLHVKIADFGLAKIIGEESFTTSLCGTPSYVAPEILVDGRHRKYTKAVDVWSLGVVLYICLCG

PatternScan: PS00108
IPR008271
98-110 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDIKPENILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox