PRGDB00071136 (Mgr.23217)

From PRG Wiki
Jump to: navigation, search
Mgr.23217
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 221894056 (DC978925)
Gene Class Unknown
Domain Type
Gene Species Magnaporthe grisea

Comment?

DC978925 Magnaporthe grisea Guy11 (NIAS) Magnaporthe grisea cDNA clone NIASMg135H07F 5', mRNA sequence

DNA Sequence

GGATCGGCGGCGGTTGAGATTATAGCAGCAATCATGGCTACCAAGAAAGAAGAAACCTTCTATGAGCTCTACCGCCGTACTAGGTACATTTGACAAGTGATCTGCTGAAAATACCAGCCATGGTATGCTATACATTGAGGAAGCCTGCTAACCTCACCATTTCCGAATACAGTCTGGGCATATGTCTCACAGATGCTCTGGACGATCTCATCACGAACGATCGTATCAACCCTCAACTCGCCATGAAGATTCTGGCGAATTTTGATCGTGTTGTGGCTGAGACTTTGCAAGAGAAAGTCAAAGCCAGACTTCAGTTCAAGGGAGCTCTCGACAACTACCGCTTTTGCGACGACGTATGGACCTTTGTGATCAAGAACATTAACTTTAAGCTGGATGGTGGCAATCAGACCATCCAAGCCGACAAAGTCAAGATTGTTAGCTGCAATGCCAAACGTCCT


Protein sequences

Name Description Sequence
Mgr.23217 translated coding region predicted by ESTScan from UniGene Mgr.23217

GSAAVEIIAAIMATKKEETFYELYRRTRYXLTSDLLKIPAMVCYTLRKPANLTISEYSLGICLTDALDDLITNDRINPQLAMKILANFDRVVAETLQEKVKARLQFKGALDNYRFCDDVWTFVIKNINFKLDGGNQTIQADKVKIVSCNAKRP

Domains

Domain Start-End Description Sequence

BlastProDom: PD009224
IPR015872
58-96 Q4WZV0_ASPFU_Q4WZV0;
Transcription initiation factor IIA, gamma subunit

SLGICLTDALDDLITNDRINPQLAMKILANFDRVVAETL

superfamily: SSF47396
IPR009083
58-101 Transcription factor IIA (TFIIA), alpha-helical domain
Transcription factor IIA, helical

SLGICLTDALDDLITNDRINPQLAMKILANFDRVVAETLQEKVK

Gene3D: G3DSA:1.10.287.190
IPR015872
58-101 no description
Transcription initiation factor IIA, gamma subunit

SLGICLTDALDDLITNDRINPQLAMKILANFDRVVAETLQEKVK

HMMPfam: PF02268
IPR015872
58-97 TFIIA_gamma_N
Transcription initiation factor IIA, gamma subunit

SLGICLTDALDDLITNDRINPQLAMKILANFDRVVAETLQ

HMMPanther: PTHR10966
IPR003194
58-152 TRANSCRIPTION INITIATION FACTOR IIA SUBUNIT 2
Transcription initiation factor IIA, gamma subunit

SLGICLTDALDDLITNDRINPQLAMKILANFDRVVAETLQEKVKARLQFKGALDNYRFCDDVWTFVIKNINFKLDGGNQTIQADKVKIVSCNAKR

superfamily: SSF50784
IPR009088
99-151 Transcription factor IIA (TFIIA), beta-barrel domain
Transcription factor IIA, beta-barrel

KVKARLQFKGALDNYRFCDDVWTFVIKNINFKLDGGNQTIQADKVKIVSCNAK

HMMPfam: PF02751
IPR015871
99-150 TFIIA_gamma_C
Transcription initiation factor IIA, gamma subunit

KVKARLQFKGALDNYRFCDDVWTFVIKNINFKLDGGNQTIQADKVKIVSCNA

Gene3D: G3DSA:2.30.18.10
IPR009088
103-152 no description
Transcription factor IIA, beta-barrel

RLQFKGALDNYRFCDDVWTFVIKNINFKLDGGNQTIQADKVKIVSCNAKR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox