PRGDB00071137 (Mgr.24155)

From PRG Wiki
Jump to: navigation, search
Mgr.24155
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 221910922 (DC964680)
Gene Class Unknown
Domain Type
Gene Species Magnaporthe grisea

Comment?

DC964680 Magnaporthe grisea Guy11 (NIAS) Magnaporthe grisea cDNA clone NIASMg047D05F 5', mRNA sequence

DNA Sequence

GTCACCAGCAGCTTCTCGATTGTCGCAGCTTTCCTACCACTTGAGTAGCACGTCTCGTCCCAGCTTGACATCTACAACTTCTTCATCCAGCTCGGACAATAGCAACAAACATTCCAAAATGTCTTCTCAACCTGAGCATCCCACCCTGCTCATTCCCGGCCCTATCGAGTTTGACGATGCTGTCCTCCAGTCCATGAGCCGTTACAGCGAGAGCCACGTTGGTCCGGCTTTTGTCAACGTTTTTGGCGAGACCTTGACCCTCCTTCGCAAACTGTTCCAGACTACGGATTCGGGCTCGCAGCCATTTGTCATCTCAGGGTCCGGCACCCTTGGATGGGATCTGGTCTCTGCCAACCTTGTCGAAGCCGGCGAGGATGTGCTGGTTCTTGGCACTGGCTACTTCAGTGACGGTTTCGCCGACTGCCTGCGAACCTATGGCGCCAACGTAACGGAGCTCAAGGCCCCCGTTGGATCCAGGCCTCAACTGCCCGAGATTGAGAAGGCTCTTAGTGCCAAGAAGTACAAAGTCCTCACCGTCACGCACGTTGACACCTCAACCGGCGTGCTCAGCGAGCTGAAGGACCTCAGCGCCATGGTGCACAAGGTCTCCCCTGAGACCCTCATCATCGCCGATGGTGTATGCAGTGTGGCTTCT


Protein sequences

Name Description Sequence
Mgr.24155 translated coding region predicted by ESTScan from UniGene Mgr.24155

XSPAASRLSQLSYHLSSTSRPSLTSTTSSSSSDNSNKHSKMSSQPEHPTLLIPGPIEFDDAVLQSMSRYSESHVGPAFVNVFGETLTLLRKLFQTTDSGSQPFVISGSGTLGWDLVSANLVEAGEDVLVLGTGYFSDGFADCLRTYGANVTELKAPVGSRPQLPEIEKALSAKKYKVLTVTHVDTSTGVLSELKDLSAMVHKVSPETLIIADGVCSVAS

Domains

Domain Start-End Description Sequence

Seg: seg
16-43 seg

SSTSRPSLTSTTSSSSSDNSNKHSKMSS

HMMPanther: PTHR21152:SF7
37-219 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

KHSKMSSQPEHPTLLIPGPIEFDDAVLQSMSRYSESHVGPAFVNVFGETLTLLRKLFQTTDSGSQPFVISGSGTLGWDLVSANLVEAGEDVLVLGTGYFSDGFADCLRTYGANVTELKAPVGSRPQLPEIEKALSAKKYKVLTVTHVDTSTGVLSELKDLSAMVHKVSPETLIIADGVCSVAS

HMMPanther: PTHR21152
37-219 FAMILY NOT NAMED,AMINOTRANSFERASE CLASS V

KHSKMSSQPEHPTLLIPGPIEFDDAVLQSMSRYSESHVGPAFVNVFGETLTLLRKLFQTTDSGSQPFVISGSGTLGWDLVSANLVEAGEDVLVLGTGYFSDGFADCLRTYGANVTELKAPVGSRPQLPEIEKALSAKKYKVLTVTHVDTSTGVLSELKDLSAMVHKVSPETLIIADGVCSVAS

superfamily: SSF53383
IPR015424
45-219 PLP-dependent transferases
Pyridoxal phosphate-dependent transferase, major d

PEHPTLLIPGPIEFDDAVLQSMSRYSESHVGPAFVNVFGETLTLLRKLFQTTDSGSQPFVISGSGTLGWDLVSANLVEAGEDVLVLGTGYFSDGFADCLRTYGANVTELKAPVGSRPQLPEIEKALSAKKYKVLTVTHVDTSTGVLSELKDLSAMVHKVSPETLIIADGVCSVAS

Gene3D: G3DSA:3.40.640.10
IPR015421
60-218 no description
Pyridoxal phosphate-dependent transferase, major r

DAVLQSMSRYSESHVGPAFVNVFGETLTLLRKLFQTTDSGSQPFVISGSGTLGWDLVSANLVEAGEDVLVLGTGYFSDGFADCLRTYGANVTELKAPVGSRPQLPEIEKALSAKKYKVLTVTHVDTSTGVLSELKDLSAMVHKVSPETLIIADGVCSVA

HMMPfam: PF00266
IPR000192
61-217 Aminotran_5
Aminotransferase, class V/Cysteine desulfurase

AVLQSMSRYSESHVGPAFVNVFGETLTLLRKLFQTTDSGSQPFVISGSGTLGWDLVSANLVEAGEDVLVLGTGYFSDGFADCLRTYGANVTELKAPVGSRPQLPEIEKALSAKKYKVLTVTHVDTSTGVLSELKDLSAMVHKVSPETLIIADGVCSV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox