PRGDB00071139 (Mtr.313)

From PRG Wiki
Jump to: navigation, search
Mtr.313
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 7564333 (AW689597)
Gene Class T
Domain Type TIR, LRR
Gene Species Medicago truncatula

Comment?

NF022B08ST1F1000 Developing stem Medicago truncatula cDNA clone NF022B08ST 5', mRNA sequence

DNA Sequence

CGAGttttttttttttATATGAACCAGAATGAATGTGTAATCCTTCACAAGAAATATATCGTAATACATGGCTATGTCCCTGGCATCTTCTTCCTCTCACCACGCTTCTTTGAAGAAATATGATGTTTTCATCAGCTTTCGAGGCGAAGATACACGCGTTGGTTTCATAAGCCATCTTTATAAAGCTTTGCGCCGAAAACATATCCATACCTACATTGACAACTTGATTGAAAAAGGAGATCAAGTTTGGGCAGAACTTGTGAAGGCAATGAAACAATCCACTTTGTTTCTTGTCGTGTTCTCGAAGAACTACGCATCTTCAACATGGTGTTTGAACGAACTGGTTGAGATAATGGAGTTATTCGACATTAACAAAAATGAAGATGACAACGTTGTTGTTATTCCTGTGTTCTACCATGTTGACCCTTCACACGTGAGGAAGCAAACTGGGAGTTATGGCACTGCCTTGGCTAAACACAAGAAGCAAGGCAACGACCATGAGATGCAAAAATGGAATACTGCTCTTTCTGAAGCTGCTAATTTGTCTGGTTTTCATTCAACCACATACAGGACTGAATCCGAATTAATTGGAGACATTACCCGGAGCTGTATTAAGAAAATTAAAATCAACAAAGCCNCAATTGATCTTACTTGTAATTTCATACCTGANTGAAAACTATCGGAGCATT


Protein sequences

Name Description Sequence
Mtr.313 translated coding region predicted by ESTScan from UniGene Mtr.313

MAMSLASSSSHHASLKKYDVFISFRGEDTRVGFISHLYKALRRKHIHTYIDNLIEKGDQVWAELVKAMKQSTLFLVVFSKNYASSTWCLNELVEIMELFDINKNEDDNVVVIPVFYHVDPSHVRKQTGSYGTALAKHKKQGNDHEMQKWNTALSEAANLSGFHSTTYRTESELIGDITRSCIKKIKINKAXIDLTCNFIPX

Domains

Domain Start-End Description Sequence

Seg: seg
4-17 seg

SLASSSSHHASLKK

superfamily: SSF52200
IPR000157
6-162 Toll/Interleukin receptor TIR domain
Toll-Interleukin receptor

ASSSSHHASLKKYDVFISFRGEDTRVGFISHLYKALRRKHIHTYIDNLIEKGDQVWAELVKAMKQSTLFLVVFSKNYASSTWCLNELVEIMELFDINKNEDDNVVVIPVFYHVDPSHVRKQTGSYGTALAKHKKQGNDHEMQKWNTALSEAANLSGF

ProfileScan: PS50104
IPR000157
16-159 TIR
Toll-Interleukin receptor

KKYDVFISFRGEDTRVGFISHLYKALRRKHIHTYIDNLIEKGDQVWAELVKAMKQSTLFLVVFSKNYASSTWCLNELVEIMELFDINKNEDDNVVVIPVFYHVDPSHVRKQTGSYGTALAKHKKQGNDHEMQKWNTALSEAANL

Gene3D: G3DSA:3.40.50.10140
16-152 no description

KKYDVFISFRGEDTRVGFISHLYKALRRKHIHTYIDNLIEKGDQVWAELVKAMKQSTLFLVVFSKNYASSTWCLNELVEIMELFDINKNEDDNVVVIPVFYHVDPSHVRKQTGSYGTALAKHKKQGNDHEMQKWNTA

HMMSmart: SM00255
IPR000157
17-159 Toll
Toll/interleukin-1 receptor homology (TIR) domain

KYDVFISFRGEDTRVGFISHLYKALRRKHIHTYIDNLIEKGDQVWAELVKAMKQSTLFLVVFSKNYASSTWCLNELVEIMELFDINKNEDDNVVVIPVFYHVDPSHVRKQTGSYGTALAKHKKQGNDHEMQKWNTALSEAANL

HMMPfam: PF01582
IPR000157
20-154 TIR
Toll-Interleukin receptor

VFISFRGEDTRVGFISHLYKALRRKHIHTYIDNLIEKGDQVWAELVKAMKQSTLFLVVFSKNYASSTWCLNELVEIMELFDINKNEDDNVVVIPVFYHVDPSHVRKQTGSYGTALAKHKKQGNDHEMQKWNTALS

HMMPanther: PTHR23155:SF344
28-185 SUBFAMILY NOT NAMED

DTRVGFISHLYKALRRKHIHTYIDNLIEKGDQVWAELVKAMKQSTLFLVVFSKNYASSTWCLNELVEIMELFDINKNEDDNVVVIPVFYHVDPSHVRKQTGSYGTALAKHKKQGNDHEMQKWNTALSEAANLSGFHSTTYRTESELIGDITRSCIKKI

HMMPanther: PTHR23155
28-185 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DTRVGFISHLYKALRRKHIHTYIDNLIEKGDQVWAELVKAMKQSTLFLVVFSKNYASSTWCLNELVEIMELFDINKNEDDNVVVIPVFYHVDPSHVRKQTGSYGTALAKHKKQGNDHEMQKWNTALSEAANLSGFHSTTYRTESELIGDITRSCIKKI

Seg: seg
182-192 seg

IKKIKINKAXI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox