PRGDB00071140 (Mtr.418)

From PRG Wiki
Jump to: navigation, search
Mtr.418
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 83665361 (DW015769)
Gene Class Unknown
Domain Type LRR
Gene Species Medicago truncatula

Comment?

EST1224730 MTY Medicago truncatula cDNA clone MTYA943, mRNA sequence

DNA Sequence

CGGCCGGGGATCCACACTTACTTTTCTATTGTTTTTCATTCACATAAACCATTTAGTAACACTTTCCAAAAAATAATCATTCATTCATGGCATGGTtgcttcttttattgcatctttttctccttcattttccatccttctcttctttcaatttttcATGCCATCGTGATGAGAGCTCTGCTCTGCTTCAGTTTAAATCCTCCTTCACTATAAATTCTGAATCTTCTTATCCTTGTGATGAATCTCTTCTGAAAACAGCAACATGGAAATATGGGACTGATTGCTGCTCATGGCATGGTGTCACATGCGACACCACTTTTGGTCGCGTGATTGGCCTCAACCTTGGCTGTGAAGGCCTCCAAGGTAACAATTTAGGTGGTTTTCTACCAAAAGCCTATTTAAGAAATTATGAAGCCATGAAGAATGTTACTCAAGTGGATGGGGATATTAGTTTGCAATATCTACACAAGTCGTATGAAAAATTCGACGCGGGATATTCAGATTCTGTGACTGTGGCAACAAAAGGGATTCAAATGAAATTGGTGAAAATTCCAATAAAGTTTGTATCTATTGATTTTTCAAGAAACAAATTTGAAGGAGAGATTCCAAATGCTATTGGAGAGCTTCATGCACTCAAAGGGCTTAACCTTTCCCACAACAGACTTACCGGTCATATTCCCAAATCCATAGGAAACTTGACATACTTGGAATCTCTGGATCTTTCCCTGAATATGTTAACCGGTGTGACTCCTGCGGAATTAACCAATTTAAACTTTCTTGAAGTCATGAATCTTTCCAATAACCATTTGGTGGGAGAAATACCTAGAGGAAGCAATTCACACATTTACAAATGAT


Protein sequences

Name Description Sequence
Mtr.418 translated coding region predicted by ESTScan from UniGene Mtr.418

MGLIAAHGMVSHATPLLVAVIGLNLGCEGLQGNNLGGFLPKAYLRNYEAMKNVTQVDGDISLQYLHKSYEKFDAGYSDSVTVATKGIQMKLVKIPIKFVSIDFSRNKFEGEIPNAIGELHALKGLNLSHNRLTGHIPKSIGNLTYLESLDLSLNMLTGVTPAELTNLNFLEVMNLSNNHLVGEIPRGSNSHIYKXX

Domains

Domain Start-End Description Sequence

superfamily: SSF52058
53-187 L domain-like,LRR

VTQVDGDISLQYLHKSYEKFDAGYSDSVTVATKGIQMKLVKIPIKFVSIDFSRNKFEGEIPNAIGELHALKGLNLSHNRLTGHIPKSIGNLTYLESLDLSLNMLTGVTPAELTNLNFLEVMNLSNNHLVGEIPRG

HMMPanther: PTHR24420
99-186 FAMILY NOT NAMED,FAMILY NOT NAMED

VSIDFSRNKFEGEIPNAIGELHALKGLNLSHNRLTGHIPKSIGNLTYLESLDLSLNMLTGVTPAELTNLNFLEVMNLSNNHLVGEIPR

Gene3D: G3DSA:3.80.10.10
100-185 no description

SIDFSRNKFEGEIPNAIGELHALKGLNLSHNRLTGHIPKSIGNLTYLESLDLSLNMLTGVTPAELTNLNFLEVMNLSNNHLVGEIP

HMMPfam: PF13855
122-180 LRR_8,Leucine rich repeat

LKGLNLSHNRLTGHIPKSIGNLTYLESLDLSLNMLTGVTPAELTNLNFLEVMNLSNNHL

FPrintScan: PR00019
146-159 LEURICHRPT,Leucine-rich repeat signature

LESLDLSLNMLTGV

FPrintScan: PR00019
167-180 LEURICHRPT,Leucine-rich repeat signature

LNFLEVMNLSNNHL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox